Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 169 (16 Oct 2019)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Voltage-dependent L-type calcium channel subunit alpha-1D

Gene

Cacna1d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, and by benzothiazepines.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei364Calcium ion selectivity and permeabilityBy similarity1
Sitei725Calcium ion selectivity and permeabilityBy similarity1
Sitei1121Calcium ion selectivity and permeabilityBy similarity1
Sitei1426Calcium ion selectivity and permeabilityBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi1513 – 1524By similarityAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-422356 Regulation of insulin secretion
R-MMU-5576892 Phase 0 - rapid depolarisation
R-MMU-5576893 Phase 2 - plateau phase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit alpha-1D
Alternative name(s):
Calcium channel, L type, alpha-1 polypeptide isoform 2
Voltage-gated calcium channel subunit alpha Cav1.3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cacna1d
Synonyms:Cach3, Cacn4, Cacnl1a2, Cchl1a2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:88293 Cacna1d

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 126CytoplasmicSequence analysisAdd BLAST126
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei127 – 145Helical; Name=S1 of repeat ISequence analysisAdd BLAST19
Topological domaini146 – 163ExtracellularSequence analysisAdd BLAST18
Transmembranei164 – 183Helical; Name=S2 of repeat ISequence analysisAdd BLAST20
Topological domaini184 – 195CytoplasmicSequence analysisAdd BLAST12
Transmembranei196 – 214Helical; Name=S3 of repeat ISequence analysisAdd BLAST19
Topological domaini215 – 235ExtracellularSequence analysisAdd BLAST21
Transmembranei236 – 254Helical; Name=S4 of repeat ISequence analysisAdd BLAST19
Topological domaini255 – 273CytoplasmicSequence analysisAdd BLAST19
Transmembranei274 – 293Helical; Name=S5 of repeat ISequence analysisAdd BLAST20
Topological domaini294 – 381ExtracellularSequence analysisAdd BLAST88
Transmembranei382 – 406Helical; Name=S6 of repeat ISequence analysisAdd BLAST25
Topological domaini407 – 543CytoplasmicSequence analysisAdd BLAST137
Transmembranei544 – 563Helical; Name=S1 of repeat IISequence analysisAdd BLAST20
Topological domaini564 – 578ExtracellularSequence analysisAdd BLAST15
Transmembranei579 – 597Helical; Name=S2 of repeat IISequence analysisAdd BLAST19
Topological domaini598 – 605CytoplasmicSequence analysis8
Transmembranei606 – 624Helical; Name=S3 of repeat IISequence analysisAdd BLAST19
Topological domaini625 – 634ExtracellularSequence analysis10
Transmembranei635 – 653Helical; Name=S4 of repeat IISequence analysisAdd BLAST19
Topological domaini654 – 672CytoplasmicSequence analysisAdd BLAST19
Transmembranei673 – 693Helical; Name=S5 of repeat IISequence analysisAdd BLAST21
Topological domaini694 – 747ExtracellularSequence analysisAdd BLAST54
Transmembranei748 – 772Helical; Name=S6 of repeat IISequence analysisAdd BLAST25
Topological domaini773 – 906CytoplasmicSequence analysisAdd BLAST134
Transmembranei907 – 925Helical; Name=S1 of repeat IIISequence analysisAdd BLAST19
Topological domaini926 – 941ExtracellularSequence analysisAdd BLAST16
Transmembranei942 – 961Helical; Name=S2 of repeat IIISequence analysisAdd BLAST20
Topological domaini962 – 973CytoplasmicSequence analysisAdd BLAST12
Transmembranei974 – 992Helical; Name=S3 of repeat IIISequence analysisAdd BLAST19
Topological domaini993 – 998ExtracellularSequence analysis6
Transmembranei999 – 1018Helical; Name=S4 of repeat IIISequence analysisAdd BLAST20
Topological domaini1019 – 1037CytoplasmicSequence analysisAdd BLAST19
Transmembranei1038 – 1057Helical; Name=S5 of repeat IIISequence analysisAdd BLAST20
Topological domaini1058 – 1147ExtracellularSequence analysisAdd BLAST90
Transmembranei1148 – 1168Helical; Name=S6 of repeat IIISequence analysisAdd BLAST21
Topological domaini1169 – 1225CytoplasmicSequence analysisAdd BLAST57
Transmembranei1226 – 1244Helical; Name=S1 of repeat IVSequence analysisAdd BLAST19
Topological domaini1245 – 1259ExtracellularSequence analysisAdd BLAST15
Transmembranei1260 – 1279Helical; Name=S2 of repeat IVSequence analysisAdd BLAST20
Topological domaini1280 – 1286CytoplasmicSequence analysis7
Transmembranei1287 – 1308Helical; Name=S3 of repeat IVSequence analysisAdd BLAST22
Topological domaini1309 – 1333ExtracellularSequence analysisAdd BLAST25
Transmembranei1334 – 1353Helical; Name=S4 of repeat IVSequence analysisAdd BLAST20
Topological domaini1354 – 1372CytoplasmicSequence analysisAdd BLAST19
Transmembranei1373 – 1392Helical; Name=S5 of repeat IVSequence analysisAdd BLAST20
Topological domaini1393 – 1459ExtracellularSequence analysisAdd BLAST67
Transmembranei1460 – 1484Helical; Name=S6 of repeat IVSequence analysisAdd BLAST25
Topological domaini1485 – 2179CytoplasmicSequence analysisAdd BLAST695

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

deafness, bradycardia and diabetic traits.3 Publications

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3988632

DrugCentral

More...
DrugCentrali
Q99246

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
530

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000539351 – 2179Voltage-dependent L-type calcium channel subunit alpha-1DAdd BLAST2179

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1495Phosphoserine; by PKABy similarity1

Keywords - PTMi

Disulfide bond, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99246

PRoteomics IDEntifications database

More...
PRIDEi
Q99246

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99246

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99246

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q99246

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the inner hair cells (IHC) of the cochlea.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 2 and isoform 3 are expressed in heart at 12.5 dpc (at protein level). Expressed in the heart at 9.5, 12.5 and 15.5 dpc. Isoform 2 and isoform 3 are expressed in heart at 9.5 and 12.5 dpc.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in CACNA1C knockout mice.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000015968 Expressed in 206 organ(s), highest expression level in pituitary gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99246 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99246 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.

Interacts (via IQ domain) with CABP1 and CABP4 in a calcium independent manner.

Interacts with RIMBP2 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
198433, 2 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q99246

Protein interaction database and analysis system

More...
IntActi
Q99246, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000107869

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q99246

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati113 – 409IAdd BLAST297
Repeati529 – 775IIAdd BLAST247
Repeati893 – 1175IIIAdd BLAST283
Repeati1212 – 1487IVAdd BLAST276

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni429 – 446Binding to the beta subunitBy similarityAdd BLAST18
Regioni1095 – 1185Dihydropyridine bindingBy similarityAdd BLAST91
Regioni1440 – 1506Dihydropyridine bindingBy similarityAdd BLAST67
Regioni1452 – 1495Phenylalkylamine bindingBy similarityAdd BLAST44

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili771 – 810Sequence analysisAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 7Poly-Met7
Compositional biasi673 – 679Poly-Leu7
Compositional biasi847 – 858Poly-GluAdd BLAST12

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Coiled coil, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2301 Eukaryota
ENOG410XNP6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154839

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231529

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99246

KEGG Orthology (KO)

More...
KOi
K04851

Identification of Orthologs from Complete Genome Data

More...
OMAi
MNGTECK

Database of Orthologous Groups

More...
OrthoDBi
172471at2759

TreeFam database of animal gene trees

More...
TreeFami
TF312805

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031688 CAC1F_C
IPR031649 GPHH_dom
IPR005821 Ion_trans_dom
IPR005452 LVDCC_a1dsu
IPR014873 VDCC_a1su_IQ
IPR005446 VDCC_L_a1su
IPR002077 VDCCAlpha1
IPR027359 Volt_channel_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08763 Ca_chan_IQ, 1 hit
PF16885 CAC1F_C, 1 hit
PF16905 GPHH, 1 hit
PF00520 Ion_trans, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00167 CACHANNEL
PR01630 LVDCCALPHA1
PR01636 LVDCCALPHA1D

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01062 Ca_chan_IQ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99246-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMMMMMMKKM QHQRQHQEDH ANEANYARGT RLPISGEGPT SQPNSSKQTV
60 70 80 90 100
LSWQAAIDAA RQAKAAQTMS TSAPPPVGSL SQRKRQQYAK SKKQGNSSNS
110 120 130 140 150
RPARALFCLS LNNPIRRACI SIVEWKPFDI FILLAIFANC VALAIYIPFP
160 170 180 190 200
EDDSNSTNHN LEKVEYAFLI IFTVETFLKI IAYGLLLHPN AYVRNGWNLL
210 220 230 240 250
DFVIVIVGLF SVILEQLTKE TEGGNHSSGK SGGFDVKALR AFRVLRPLRL
260 270 280 290 300
VSGVPSLQVV LNSIIKAMVP LLHIALLVLF VIIIYAIIGL ELFIGKMHKT
310 320 330 340 350
CFFADSDIVA EEDPAPCAFS GNGRQCTANG TECRSGWVGP NGGITNFDNF
360 370 380 390 400
AFAMLTVFQC ITMEGWTDVL YWVNDAIGWE WPWVYFVSLI ILGSFFVLNL
410 420 430 440 450
VLGVLSGEFS KEREKAKARG DFQKLREKQQ LEEDLKGYLD WITQAEDIDP
460 470 480 490 500
ENEEEGGEEG KRNTSMPTSE TESVNTENVS GEGETQGCCG TLWCWWKRRG
510 520 530 540 550
AAKTGPSGCR RWGQAISKSK LSRRWRRWNR FNRRRCRAAV KSVTFYWLVI
560 570 580 590 600
VLVFLNTLTI SSEHYNQPDW LTQIQDIANK VLLALFTCEM LVKMYSLGLQ
610 620 630 640 650
AYFVSLFNRF DCFVVCGGIT ETILVELELM SPLGVSVFRC VRLLRIFKVT
660 670 680 690 700
RHWTSLSNLV ASLLNSMKSI ASLLLLLFLF IIIFSLLGMQ LFGGKFNFDE
710 720 730 740 750
TQTKRSTFDN FPQALLTVFQ ILTGEDWNAV MYDGIMAYGG PSSSGMIVCI
760 770 780 790 800
YFIILFICGN YILLNVFLAI AVDNLADAES LNTAQKEEAE EKERKKIARK
810 820 830 840 850
ESLENKKNNK PEVNQIANSD NKVTIDDYQE DAEDKDPYPP CDVPVGEEEE
860 870 880 890 900
EEEEDEPEVP AGPRPRRISE LNMKEKIAPI PEGSAFFILS KTNPIRVGCH
910 920 930 940 950
KLINHHIFTN LILVFIMLSS AALAAEDPIR SHSFRNTILG YFDYAFTAIF
960 970 980 990 1000
TVEILLKMTT FGAFLHKGAF CRNYFNLLDM LVVGVSLVSF GIQSSAISVV
1010 1020 1030 1040 1050
KILRVLRVLR PLRAINRAKG LKHVVQCVFV AIRTIGNIMI VTTLLQFMFA
1060 1070 1080 1090 1100
CIGVQLFKGK FYRCTDEAKS NPEECRGLFI LYKDGDVDSP VVRERIWQNS
1110 1120 1130 1140 1150
DFNFDNVLSA MMALFTVSTF EGWPALLYKA IDSNGENVGP VYNYRVEISI
1160 1170 1180 1190 1200
FFIIYIIIVA FFMMNIFVGF VIVTFQEQGE KEYKNCELDK NQRQCVEYAL
1210 1220 1230 1240 1250
KARPLRRYIP KNPYQYKFWY VVNSSPFEYM MFVLIMLNTL CLAMQHYEQS
1260 1270 1280 1290 1300
KMFNDAMDIL NMVFTGVFTV EMVLKVIAFK PKGYFSDAWN TFDSLIVIGS
1310 1320 1330 1340 1350
IIDVALSEAD PSESETIPLP TATPGNSEES NRISITFFRL FRVMRLVKLL
1360 1370 1380 1390 1400
SRGEGIRTLL WTFIKSFQAL PYVALLIAML FFIYAVIGMQ MFGKVAMRDN
1410 1420 1430 1440 1450
NQINRNNNFQ TFPQAVLLLF RCATGEAWQE IMLACLPGKL CDPDSDYNPG
1460 1470 1480 1490 1500
EEYTCGSNFA IVYFISFYML CAFLIINLFV AVIMDNFDYL TRDWSILGPH
1510 1520 1530 1540 1550
HLDEFKRIWS EYDPEAKGRI KHLDVVTLLR RIQPPLGFGK LCPHRVACKR
1560 1570 1580 1590 1600
LVAMNMPLNS DGTVMFNATL FALVRTALKI KTEGNLEQAN EELRAVIKKI
1610 1620 1630 1640 1650
WKKTSMKLLD QVVPPAGDDE VTVGKFYATF LIQDYFRKFK KRKEQGLVGK
1660 1670 1680 1690 1700
YPAKNTTIAL QAGLRTLHDI GPEIRRAISC DLQDDEPEDS KPEEEDVFKR
1710 1720 1730 1740 1750
NGALLGNHVN HVNSDRRDSL QQTNTTHRPL HVQRPSMPPA SDTEKPLFPP
1760 1770 1780 1790 1800
AGNSGCHNHH NHNSIGKQAP TSTNANLNNA NMSKAAHGKP PSIGNLEHVS
1810 1820 1830 1840 1850
ENGHYSCKHD RELQRRSSIK RTRYYETYIR SESGDEQFPT ICREDPEIHG
1860 1870 1880 1890 1900
YFRDPRCLGE QEYFSSEECC EDDSSPTWSR QNYNYYNRYP GSSMDFERPR
1910 1920 1930 1940 1950
GYHHPQGFLE DDDSPTGYDS RRSPRRRLLP PTPPSHRRSS FNFECLRRQS
1960 1970 1980 1990 2000
SQDDVLPSPA LPHRAALPLH LMQQQIMAVA GLDSSKAQKY SPSHSTRSWA
2010 2020 2030 2040 2050
TPPATPPYRD WSPCYTPLIQ VDRSESMDQV NGSLPSLHRS SWYTDEPDIS
2060 2070 2080 2090 2100
YRTFTPASLT VPSSFRNKNS DKQRSADSLV EAVLISEGLG RYARDPKFVS
2110 2120 2130 2140 2150
ATKHEIADAC DLTIDEMESA ASTLLNGSVC PRANGDMGPI SHRQDYELQD
2160 2170
FGPGYSDEEP DPGREEEDLA DEMICITTL
Length:2,179
Mass (Da):247,061
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBEED5EF140E75782
GO
Isoform 2 (identifier: Q99246-3) [UniParc]FASTAAdd to basket
Also known as: Cav1.3(1a)

The sequence of this isoform differs from the canonical sequence as follows:
     493-513: WCWWKRRGAAKTGPSGCRRWG → C
     1311-1325: Missing.

Show »
Length:2,144
Mass (Da):243,198
Checksum:i2CDC0111051527D3
GO
Isoform 3 (identifier: Q99246-4) [UniParc]FASTAAdd to basket
Also known as: Cav1.3(1b)

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MMMMMMMKKMQHQRQHQEDHAN → MNLPTFSSDLILIKSVLSQETDARYKGRVVSAVESTEDFSQAFA
     493-513: WCWWKRRGAAKTGPSGCRRWG → C
     1311-1325: Missing.

Show »
Length:2,166
Mass (Da):245,217
Checksum:i842E4AD6D5F07A91
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YCE7A0A286YCE7_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
513Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YD72A0A286YD72_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
2,159Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2C9F2E5A0A2C9F2E5_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
2,187Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A286YE45A0A286YE45_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BDE8A0A571BDE8_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
284Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BDT1A0A571BDT1_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
1,647Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BEQ4A0A571BEQ4_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
1,643Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BF73A0A571BF73_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A571BG56A0A571BG56_MOUSE
Voltage-dependent L-type calcium ch...
Cacna1d
223Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti445A → V in CAD26883 (PubMed:12900400).Curated1
Sequence conflicti445A → V in CAD26884 (PubMed:12900400).Curated1
Sequence conflicti868I → T in CAD26883 (PubMed:12900400).Curated1
Sequence conflicti868I → T in CAD26884 (PubMed:12900400).Curated1
Sequence conflicti1871E → G in CAD26883 (PubMed:12900400).Curated1
Sequence conflicti1871E → G in CAD26884 (PubMed:12900400).Curated1
Sequence conflicti2043Y → S in BAC77259 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0270901 – 22MMMMM…EDHAN → MNLPTFSSDLILIKSVLSQE TDARYKGRVVSAVESTEDFS QAFA in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_027091493 – 513WCWWK…CRRWG → C in isoform 2 and isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_0270921311 – 1325Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ437291 mRNA Translation: CAD26883.1
AJ437292 mRNA Translation: CAD26884.1
AB086123 mRNA Translation: BAC77259.1
AC119886 Genomic DNA No translation available.
AC154305 Genomic DNA No translation available.
AC154669 Genomic DNA No translation available.
AC154690 Genomic DNA No translation available.
CT009536 Genomic DNA No translation available.
M57975 mRNA Translation: AAA63292.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36846.1 [Q99246-4]
CCDS36847.1 [Q99246-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001077085.1, NM_001083616.2 [Q99246-3]
NP_001289566.1, NM_001302637.1 [Q99246-2]
NP_083257.2, NM_028981.3 [Q99246-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000112250; ENSMUSP00000107869; ENSMUSG00000015968 [Q99246-4]
ENSMUST00000224198; ENSMUSP00000153250; ENSMUSG00000015968 [Q99246-3]
ENSMUST00000238504; ENSMUSP00000158632; ENSMUSG00000015968 [Q99246-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12289

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:12289

UCSC genome browser

More...
UCSCi
uc007suu.2 mouse [Q99246-3]
uc007suw.2 mouse [Q99246-2]
uc007sux.2 mouse [Q99246-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437291 mRNA Translation: CAD26883.1
AJ437292 mRNA Translation: CAD26884.1
AB086123 mRNA Translation: BAC77259.1
AC119886 Genomic DNA No translation available.
AC154305 Genomic DNA No translation available.
AC154669 Genomic DNA No translation available.
AC154690 Genomic DNA No translation available.
CT009536 Genomic DNA No translation available.
M57975 mRNA Translation: AAA63292.1
CCDSiCCDS36846.1 [Q99246-4]
CCDS36847.1 [Q99246-3]
RefSeqiNP_001077085.1, NM_001083616.2 [Q99246-3]
NP_001289566.1, NM_001302637.1 [Q99246-2]
NP_083257.2, NM_028981.3 [Q99246-4]

3D structure databases

SMRiQ99246
ModBaseiSearch...

Protein-protein interaction databases

BioGridi198433, 2 interactors
CORUMiQ99246
IntActiQ99246, 2 interactors
STRINGi10090.ENSMUSP00000107869

Chemistry databases

ChEMBLiCHEMBL3988632
DrugCentraliQ99246
GuidetoPHARMACOLOGYi530

PTM databases

iPTMnetiQ99246
PhosphoSitePlusiQ99246
SwissPalmiQ99246

Proteomic databases

PaxDbiQ99246
PRIDEiQ99246

Genome annotation databases

EnsembliENSMUST00000112250; ENSMUSP00000107869; ENSMUSG00000015968 [Q99246-4]
ENSMUST00000224198; ENSMUSP00000153250; ENSMUSG00000015968 [Q99246-3]
ENSMUST00000238504; ENSMUSP00000158632; ENSMUSG00000015968 [Q99246-2]
GeneIDi12289
KEGGimmu:12289
UCSCiuc007suu.2 mouse [Q99246-3]
uc007suw.2 mouse [Q99246-2]
uc007sux.2 mouse [Q99246-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
776
MGIiMGI:88293 Cacna1d

Phylogenomic databases

eggNOGiKOG2301 Eukaryota
ENOG410XNP6 LUCA
GeneTreeiENSGT00940000154839
HOGENOMiHOG000231529
InParanoidiQ99246
KOiK04851
OMAiMNGTECK
OrthoDBi172471at2759
TreeFamiTF312805

Enzyme and pathway databases

ReactomeiR-MMU-422356 Regulation of insulin secretion
R-MMU-5576892 Phase 0 - rapid depolarisation
R-MMU-5576893 Phase 2 - plateau phase

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Cacna1d mouse

Protein Ontology

More...
PROi
PR:Q99246

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000015968 Expressed in 206 organ(s), highest expression level in pituitary gland
ExpressionAtlasiQ99246 baseline and differential
GenevisibleiQ99246 MM

Family and domain databases

Gene3Di1.20.120.350, 4 hits
InterProiView protein in InterPro
IPR031688 CAC1F_C
IPR031649 GPHH_dom
IPR005821 Ion_trans_dom
IPR005452 LVDCC_a1dsu
IPR014873 VDCC_a1su_IQ
IPR005446 VDCC_L_a1su
IPR002077 VDCCAlpha1
IPR027359 Volt_channel_dom_sf
PfamiView protein in Pfam
PF08763 Ca_chan_IQ, 1 hit
PF16885 CAC1F_C, 1 hit
PF16905 GPHH, 1 hit
PF00520 Ion_trans, 4 hits
PRINTSiPR00167 CACHANNEL
PR01630 LVDCCALPHA1
PR01636 LVDCCALPHA1D
SMARTiView protein in SMART
SM01062 Ca_chan_IQ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAC1D_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99246
Secondary accession number(s): Q7TSD2, Q8R2I9, Q8R2J0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: July 27, 2011
Last modified: October 16, 2019
This is version 169 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again