Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 115 (07 Oct 2020)
Sequence version 2 (15 Jul 1999)
Previous versions | rss
Add a publicationFeedback
Protein

Voltage-dependent L-type calcium channel subunit alpha-1D

Gene

CACNA1D

Organism
Mesocricetus auratus (Golden hamster)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Voltage-sensitive calcium channels (VSCC) mediate the entry of calcium ions into excitable cells and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, gene expression, cell motility, cell division and cell death. The isoform alpha-1D gives rise to L-type calcium currents. Long-lasting (L-type) calcium channels belong to the 'high-voltage activated' (HVA) group. They are blocked by dihydropyridines (DHP), phenylalkylamines, and by benzothiazepines.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei363Calcium ion selectivity and permeabilityBy similarity1
Sitei704Calcium ion selectivity and permeabilityBy similarity1
Sitei1099Calcium ion selectivity and permeabilityBy similarity1
Sitei1404Calcium ion selectivity and permeabilityBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi1491 – 1502Sequence analysisAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit alpha-1D
Alternative name(s):
Calcium channel, L type, alpha-1 polypeptide isoform 2
Voltage-gated calcium channel subunit alpha Cav1.3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CACNA1D
Synonyms:CACH3, CACN4, CACNL1A2, CCHL1A2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMesocricetus auratus (Golden hamster)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10036 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaCricetidaeCricetinaeMesocricetus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000189706 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Genome assembly

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 125CytoplasmicSequence analysisAdd BLAST125
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei126 – 144Helical; Name=S1 of repeat ISequence analysisAdd BLAST19
Topological domaini145 – 162ExtracellularSequence analysisAdd BLAST18
Transmembranei163 – 182Helical; Name=S2 of repeat ISequence analysisAdd BLAST20
Topological domaini183 – 194CytoplasmicSequence analysisAdd BLAST12
Transmembranei195 – 213Helical; Name=S3 of repeat ISequence analysisAdd BLAST19
Topological domaini214 – 234ExtracellularSequence analysisAdd BLAST21
Transmembranei235 – 253Helical; Name=S4 of repeat ISequence analysisAdd BLAST19
Topological domaini254 – 272CytoplasmicSequence analysisAdd BLAST19
Transmembranei273 – 292Helical; Name=S5 of repeat ISequence analysisAdd BLAST20
Topological domaini293 – 380ExtracellularSequence analysisAdd BLAST88
Transmembranei381 – 405Helical; Name=S6 of repeat ISequence analysisAdd BLAST25
Topological domaini406 – 522CytoplasmicSequence analysisAdd BLAST117
Transmembranei523 – 542Helical; Name=S1 of repeat IISequence analysisAdd BLAST20
Topological domaini543 – 557ExtracellularSequence analysisAdd BLAST15
Transmembranei558 – 576Helical; Name=S2 of repeat IISequence analysisAdd BLAST19
Topological domaini577 – 584CytoplasmicSequence analysis8
Transmembranei585 – 603Helical; Name=S3 of repeat IISequence analysisAdd BLAST19
Topological domaini604 – 613ExtracellularSequence analysis10
Transmembranei614 – 632Helical; Name=S4 of repeat IISequence analysisAdd BLAST19
Topological domaini633 – 651CytoplasmicSequence analysisAdd BLAST19
Transmembranei652 – 672Helical; Name=S5 of repeat IISequence analysisAdd BLAST21
Topological domaini673 – 726ExtracellularSequence analysisAdd BLAST54
Transmembranei727 – 751Helical; Name=S6 of repeat IISequence analysisAdd BLAST25
Topological domaini752 – 884CytoplasmicSequence analysisAdd BLAST133
Transmembranei885 – 903Helical; Name=S1 of repeat IIISequence analysisAdd BLAST19
Topological domaini904 – 919ExtracellularSequence analysisAdd BLAST16
Transmembranei920 – 939Helical; Name=S2 of repeat IIISequence analysisAdd BLAST20
Topological domaini940 – 951CytoplasmicSequence analysisAdd BLAST12
Transmembranei952 – 970Helical; Name=S3 of repeat IIISequence analysisAdd BLAST19
Topological domaini971 – 976ExtracellularSequence analysis6
Transmembranei977 – 996Helical; Name=S4 of repeat IIISequence analysisAdd BLAST20
Topological domaini997 – 1015CytoplasmicSequence analysisAdd BLAST19
Transmembranei1016 – 1035Helical; Name=S5 of repeat IIISequence analysisAdd BLAST20
Topological domaini1036 – 1125ExtracellularSequence analysisAdd BLAST90
Transmembranei1126 – 1146Helical; Name=S6 of repeat IIISequence analysisAdd BLAST21
Topological domaini1147 – 1203CytoplasmicSequence analysisAdd BLAST57
Transmembranei1204 – 1222Helical; Name=S1 of repeat IVSequence analysisAdd BLAST19
Topological domaini1223 – 1237ExtracellularSequence analysisAdd BLAST15
Transmembranei1238 – 1257Helical; Name=S2 of repeat IVSequence analysisAdd BLAST20
Topological domaini1258 – 1264CytoplasmicSequence analysis7
Transmembranei1265 – 1286Helical; Name=S3 of repeat IVSequence analysisAdd BLAST22
Topological domaini1287 – 1311ExtracellularSequence analysisAdd BLAST25
Transmembranei1312 – 1331Helical; Name=S4 of repeat IVSequence analysisAdd BLAST20
Topological domaini1332 – 1350CytoplasmicSequence analysisAdd BLAST19
Transmembranei1351 – 1370Helical; Name=S5 of repeat IVSequence analysisAdd BLAST20
Topological domaini1371 – 1437ExtracellularSequence analysisAdd BLAST67
Transmembranei1438 – 1462Helical; Name=S6 of repeat IVSequence analysisAdd BLAST25
Topological domaini1463 – 1610CytoplasmicSequence analysisAdd BLAST148

Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000539341 – 1610Voltage-dependent L-type calcium channel subunit alpha-1DAdd BLAST1610

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi154N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi224N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi328N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, heart and skeletal muscle.

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Voltage-dependent calcium channels are multisubunit complexes, consisting of alpha-1, alpha-2, beta and delta subunits in a 1:1:1:1 ratio. The channel activity is directed by the pore-forming and voltage-sensitive alpha-1 subunit. In many cases, this subunit is sufficient to generate voltage-sensitive calcium channel activity. The auxiliary subunits beta and alpha-2/delta linked by a disulfide bridge regulate the channel activity.

Interacts with RIMBP2.

Interacts with CABP1 and CABP4, resulting in a near elimination of calcium-dependent inactivation of the channel (By similarity).

By similarity

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10036.XP_005077775.1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati112 – 408IAdd BLAST297
Repeati508 – 754IIAdd BLAST247
Repeati871 – 1153IIIAdd BLAST283
Repeati1190 – 1465IVAdd BLAST276

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni428 – 445Binding to the beta subunitBy similarityAdd BLAST18
Regioni1073 – 1163Dihydropyridine bindingBy similarityAdd BLAST91
Regioni1418 – 1484Dihydropyridine bindingBy similarityAdd BLAST67
Regioni1430 – 1473Phenylalkylamine bindingBy similarityAdd BLAST44

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 6Poly-Met6
Compositional biasi652 – 658Poly-Leu7
Compositional biasi826 – 836Poly-GluAdd BLAST11

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments probably represent the voltage-sensor and are characterized by a series of positively charged amino acids at every third position.

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2301, Eukaryota

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.120.350, 4 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031649, GPHH_dom
IPR005821, Ion_trans_dom
IPR005452, LVDCC_a1dsu
IPR014873, VDCC_a1su_IQ
IPR005446, VDCC_L_a1su
IPR002077, VDCCAlpha1
IPR027359, Volt_channel_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08763, Ca_chan_IQ, 1 hit
PF16905, GPHH, 1 hit
PF00520, Ion_trans, 4 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00167, CACHANNEL
PR01630, LVDCCALPHA1
PR01636, LVDCCALPHA1D

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.
Isoform HCA3A (identifier: Q99244-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMMMMMKKMQ HQRQQQEDHA NEANYARGTR PPISGEGPTS QPNSSKQTVL
60 70 80 90 100
SWQAAIDAAR QAKAAQTMST SAPPPVGSLS QRKRQQYAKS KKQGNSSNSR
110 120 130 140 150
PARALFCLSL NNPIRRACIS IVEWKPFDIF ILLAIFANCV ALAIYIPFPE
160 170 180 190 200
DDSNSTNHNL EKVEYAFLII FTVETFLKII AYGLLLHPNA YVRNGWNLLD
210 220 230 240 250
FVIVIVGLFS VILEQLTKET EGGNHSSGKS GGFDVKALRA FRVLRPLRLV
260 270 280 290 300
SGVPSLQVVL NSIIKAMVPL LHIALLVLFV IIIYAIIGLE LFIGKMHKTC
310 320 330 340 350
FFADSDIVAE EDPAPCAFSG NGRQCAVNGT ECRSGWVGPN GGITNFDNFA
360 370 380 390 400
FAMLTVFQCI TMEGWTDVLY WMNDAMGFEL PWVYFVSLVI FGSFFVLNLV
410 420 430 440 450
LGVLSGEFSK EREKAKARGD FQKLRENEQL EEDLKGYLDW ITQAEDIDPE
460 470 480 490 500
NEEEGGEEGK RNTSMPTSET ESVNTENVSG EGETQGSCGS LCQAISKSKL
510 520 530 540 550
SRRWRRWNRF NRRRCRAAVK SVTFYWLVIV LVFLNTLTIS SEHYNQPDWL
560 570 580 590 600
TQIQDIANKV LLALFTCEML VKMYSLGLQA YFVSLFNRFD CFVVCGGITE
610 620 630 640 650
TILVELELMS PLGVSVFRCV RLLRIFKVTR HWTSLSNLVA SLLNSMKSIA
660 670 680 690 700
SLLLLLFLFI IIFSLLGMQL FGGKFNFDET QTKRSTFDNF PQALLTVFQI
710 720 730 740 750
LTGEDWNAVM YDGIMAYGGP SSSGMIVCIY FIILFICGNY ILLNVFLAIA
760 770 780 790 800
VDNLADAESL NTAQKEEAEE KERKKIARKE SLENKKNNKP EVNQIANSDN
810 820 830 840 850
KVTIDDYQEE TEDKDPYPPC DVPVGEEEEE EEEEPEVPAG PRPRRISELN
860 870 880 890 900
MKEKIVPIPE GSAFFILSKT NPIRVGCHKL INHHIFTNLI LVFIMLSSAA
910 920 930 940 950
LAAEDPIRSH SFRNTILGYF DYAFTAIFTV EILLKMTTFG AFLHKGAFCR
960 970 980 990 1000
NYFNLLDMLV VGVSLVSFGI QSSAISVVKI LRVLRVLRPL RAINRAKGLK
1010 1020 1030 1040 1050
HVVQCVFVAI RTIGNIMIVT TLLQFMFACI GVQLFKGKFY RCTDEAKSNP
1060 1070 1080 1090 1100
EECRGLFILY KDGDVDSPVV RERIWQNSDF NFDNVLSAMM ALFTVSTFEG
1110 1120 1130 1140 1150
WPALLYKAID SNGENAGPVY NHRVEISIFF IIYIIIVAFF MMNIFVGFVI
1160 1170 1180 1190 1200
VTFQEQGEKE YKNCELDKNQ RQCVEYALKA RPLRRYIPKN PYQYKFWYVV
1210 1220 1230 1240 1250
NSSPFEYMMF VLIMLNTLCL AMQHYEQSKM FNDAMDILNM VFTGVFTVEM
1260 1270 1280 1290 1300
VLKVIAFKPK GYFSDAWNTF DSLIVIGSII DVALSEADPT ESESLPLPTA
1310 1320 1330 1340 1350
TPGNSEESNR ISITFFRLFR VMRLVKLLSR GEGIRTLLWT FIKSFQALPY
1360 1370 1380 1390 1400
VALLIAMLFF IYAVIGMQMF GKVAMRDNNQ INRNNNFQTF PQAVLLLFRC
1410 1420 1430 1440 1450
ATGEAWQEIM LACLPGKLCD PDSDYNPGEE YTCGSNFAIV YFISFYMLCA
1460 1470 1480 1490 1500
FLIINLFVAV IMDNFDYLTR DWSILGPHHL DEFKRIWSEY DPEAKGRIKH
1510 1520 1530 1540 1550
LDVVTLLRRI QPPLGFGKLC PHRVACKRLV AMNMPLNSDG TVMFNATLFA
1560 1570 1580 1590 1600
LVRTALKIKT EGNLEQANEE LRAVIKKIWK KTSMKLLDQV VPPAGGQCGL
1610
CFLSPSRSRS
Length:1,610
Mass (Da):182,328
Last modified:July 15, 1999 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB3B2E3794D936F79
GO
Isoform CACH3B (identifier: Q99244-3)
Sequence is not available
Length:
Mass (Da):
Isoform CACH3D (identifier: Q99244-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1261-1303: GYFSDAWNTFDSLIVIGSIIDVALSEADPTESESLPLPTATPG → HYFTDAWNTFDALIVVGSVVDIAITEVN

Show »
Length:1,595
Mass (Da):180,941
Checksum:iBA9DAFC7D6974F0F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0009151261 – 1303GYFSD…TATPG → HYFTDAWNTFDALIVVGSVV DIAITEVN in isoform CACH3D. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
M57969 mRNA Translation: AAB59702.1
M57970 mRNA Translation: AAA62807.1

Protein sequence database of the Protein Information Resource

More...
PIRi
A46227

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M57969 mRNA Translation: AAB59702.1
M57970 mRNA Translation: AAA62807.1
PIRiA46227

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10036.XP_005077775.1

Phylogenomic databases

eggNOGiKOG2301, Eukaryota

Family and domain databases

Gene3Di1.20.120.350, 4 hits
InterProiView protein in InterPro
IPR031649, GPHH_dom
IPR005821, Ion_trans_dom
IPR005452, LVDCC_a1dsu
IPR014873, VDCC_a1su_IQ
IPR005446, VDCC_L_a1su
IPR002077, VDCCAlpha1
IPR027359, Volt_channel_dom_sf
PfamiView protein in Pfam
PF08763, Ca_chan_IQ, 1 hit
PF16905, GPHH, 1 hit
PF00520, Ion_trans, 4 hits
PRINTSiPR00167, CACHANNEL
PR01630, LVDCCALPHA1
PR01636, LVDCCALPHA1D

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAC1D_MESAU
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q99244
Secondary accession number(s): Q99245
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1999
Last sequence update: July 15, 1999
Last modified: October 7, 2020
This is version 115 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again