Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Mucin-4

Gene

MUC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in tumor progression. Ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation. Has anti-adhesive properties. Seems to alter cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and in its ability to act as an intramembrane ligand for ERBB2. Plays an important role in cell proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. The MUC4-ERBB2 complex causes site-specific phosphorylation of the ERBB2 'Tyr-1248'. In polarized epithelial cells segregates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation.4 Publications

Miscellaneous

Expression is a very useful predictor of poor prognosis in patients with invasive ductal carcinoma and intrahepatic cholangiocarcinoma, mass forming type (IDC,ICC-MF). Patients with IDC or ICC-MF who have high MUC4 expression had a worse survival rate than those with low MUC4 expression.

GO - Molecular functioni

  • ErbB-2 class receptor binding Source: ProtInc
  • extracellular matrix constituent, lubricant activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

ReactomeiR-HSA-5083625 Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
R-HSA-5083632 Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
R-HSA-5083636 Defective GALNT12 causes colorectal cancer 1 (CRCS1)
R-HSA-5621480 Dectin-2 family
R-HSA-913709 O-linked glycosylation of mucins
R-HSA-977068 Termination of O-glycan biosynthesis
SIGNORiQ99102

Names & Taxonomyi

Protein namesi
Recommended name:
Mucin-4
Short name:
MUC-4
Alternative name(s):
Ascites sialoglycoprotein
Short name:
ASGP
Pancreatic adenocarcinoma mucin
Testis mucin
Tracheobronchial mucin
Cleaved into the following 2 chains:
Alternative name(s):
Ascites sialoglycoprotein 1
Short name:
ASGP-1
Alternative name(s):
Ascites sialoglycoprotein 2
Short name:
ASGP-2
Gene namesi
Name:MUC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000145113.21
HGNCiHGNC:7514 MUC4
MIMi158372 gene
neXtProtiNX_Q99102

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei2126 – 2146HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi4585
OpenTargetsiENSG00000145113
PharmGKBiPA31319

Polymorphism and mutation databases

BioMutaiMUC4
DMDMi338817990

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 28Sequence analysisAdd BLAST28
ChainiPRO_000015895629 – 2169Mucin-4Add BLAST2141
ChainiPRO_000027422529 – 1444Mucin-4 alpha chainAdd BLAST1416
ChainiPRO_00002742261445 – 2169Mucin-4 beta chainAdd BLAST725

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi161O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi235N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi260N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi622N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1472N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1525N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1544N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1553N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1588N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1609N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1632N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1659N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1685N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1703N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1739N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1754N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1802N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1809N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi1857N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1876N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi1879 ↔ 1890By similarity
Disulfide bondi1884 ↔ 1902By similarity
Disulfide bondi1904 ↔ 1913By similarity
Glycosylationi1942N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1949N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2049N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi2081 ↔ 2092By similarity
Disulfide bondi2086 ↔ 2101By similarity
Disulfide bondi2103 ↔ 2116By similarity

Post-translational modificationi

Proteolytically cleaved into 2 chains, mucin-4 alpha chain and mucin-4 beta chain.
mucrnin-4 alpha chain is highly O-glycosylated.1 Publication
mucin-4 beta chain is predominantly N-glycosylated.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei1444 – 1445Cleavage2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ99102
PaxDbiQ99102
PeptideAtlasiQ99102
PRIDEiQ99102
ProteomicsDBi78234
78235 [Q99102-10]
78236 [Q99102-11]
78237 [Q99102-12]
78238 [Q99102-13]
78239 [Q99102-15]
78240 [Q99102-16]
78241 [Q99102-17]
78242 [Q99102-2]
78243 [Q99102-3]
78244 [Q99102-5]
78245 [Q99102-7]
78246 [Q99102-8]
78247 [Q99102-9]
TopDownProteomicsiQ99102-3 [Q99102-3]

PTM databases

GlyConnecti374
iPTMnetiQ99102
PhosphoSitePlusiQ99102
UniCarbKBiQ99102

Expressioni

Tissue specificityi

Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, squamous cell carcinomas of the upper aerodigestive tract, mammary carcinomas, biliary tract, colon, and cervix cancers. Minimally or not expressed in the normal pancreas or chronic pancreatitis, but is highly expressed in pancreatic tumors and pancreatic tumor cell lines.4 Publications

Developmental stagei

Expressed early in the primitive gut before respiratory and digestive epithelial cells have acquired their tissue and cell specificity. Expressed at the basal surface of the epithelium from week 14 to 26 weeks and then predominantly localized in only parietal cells. Immediately before birth, found in the cytoplasm of the mucous columnar epithelial cells. In the embryo expressed in skin, then disappears late in gestation.1 Publication

Gene expression databases

BgeeiENSG00000145113 Expressed in 134 organ(s), highest expression level in nasal cavity epithelium
ExpressionAtlasiQ99102 baseline and differential
GenevisibleiQ99102 HS

Organism-specific databases

HPAiCAB013536
HPA005895

Interactioni

Subunit structurei

A heterodimeric complex, composed of a mucin-4 alpha chain and a cysteine-rich transmembrane mucin-4 beta chain. Mucin-4 beta chain interacts with ERBB2 via the EGF-like domain 1. In nonpolarized cells, associates with ERBB2 and ERBB3 (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ99102, 1 interactor
STRINGi9606.ENSP00000417498

Structurei

3D structure databases

SMRiQ99102
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1154 – 1309NIDOPROSITE-ProRule annotationAdd BLAST156
Domaini1310 – 1425AMOPPROSITE-ProRule annotationAdd BLAST116
Domaini1438 – 1673VWFDPROSITE-ProRule annotationAdd BLAST236
Domaini1875 – 1914EGF-like 1PROSITE-ProRule annotationAdd BLAST40
Domaini2078 – 2117EGF-like 2PROSITE-ProRule annotationAdd BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1002 – 1038RepeatAdd BLAST37

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi793 – 1013Ser-richAdd BLAST221

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IHUZ Eukaryota
ENOG4111F6U LUCA
GeneTreeiENSGT00730000110943
HOVERGENiHBG081997
InParanoidiQ99102
KOiK22017

Family and domain databases

InterProiView protein in InterPro
IPR005533 AMOP_dom
IPR000742 EGF-like_dom
IPR003886 NIDO_dom
IPR001846 VWF_type-D
PfamiView protein in Pfam
PF06119 NIDO, 1 hit
PF00094 VWD, 1 hit
SMARTiView protein in SMART
SM00723 AMOP, 1 hit
SM00181 EGF, 3 hits
SM00539 NIDO, 1 hit
SM00216 VWD, 1 hit
PROSITEiView protein in PROSITE
PS50856 AMOP, 1 hit
PS00022 EGF_1, 1 hit
PS50026 EGF_3, 2 hits
PS51220 NIDO, 1 hit
PS51233 VWFD, 1 hit

Sequences (14+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 14 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms exist.

This entry has 14 described isoforms and 55 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q99102-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKGARWRRVP WVSLSCLCLC LLPHVVPGTT EDTLITGSKT AAPVTSTGST
60 70 80 90 100
TATLEGQSTA ASSRTSNQDI SASSQNHQTK STETTSKAQT DTLTQMMTST
110 120 130 140 150
LFSSPSVHNV METVTQETAP PDEMTTSFPS SVTNTLMMTS KTITMTTSTD
160 170 180 190 200
STLGNTEETS TAGTESSTPV TSAVSITAGQ EGQSRTTSWR TSIQDTSASS
210 220 230 240 250
QNHWTRSTQT TRESQTSTLT HRTTSTPSFS PSVHNVTGTV SQKTSPSGET
260 270 280 290 300
ATSSLCSVTN TSMMTSEKIT VTTSTGSTLG NPGETSSVPV TGSLMPVTSA
310 320 330 340 350
ALVTVDPEGQ SPATFSRTST QDTTAFSKNH QTQSVETTRV SQINTLNTLT
360 370 380 390 400
PVTTSTVLSS PSGFNPSGTV SQETFPSGET TISSPSSVSN TFLVTSKVFR
410 420 430 440 450
MPISRDSTLG NTEETSLSVS GTISAITSKV STIWWSDTLS TALSPSSLPP
460 470 480 490 500
KISTAFHTQQ SEGAETTGRP HERSSFSPGV SQEIFTLHET TTWPSSFSSK
510 520 530 540 550
GHTTWSQTEL PSTSTGAATR LVTGNPSTRA AGTIPRVPSK VSAIGEPGEP
560 570 580 590 600
TTYSSHSTTL PKTTGAGAQT QWTQETGTTG EALLSSPSYS VIQMIKTATS
610 620 630 640 650
PSSSPMLDRH TSQQITTAPS TNHSTIHSTS TSPQESPAVS QRGHTRAPQT
660 670 680 690 700
TQESQTTRSV SPMTDTKTVT TPGSSFTASG HSPSEIVPQD APTISAATTF
710 720 730 740 750
APAPTGNGHT TQAPTTALQA APSSHDATLG PSGGTSLSKT GALTLANSVV
760 770 780 790 800
STPGGPEGQW TSASASTSPD TAAAMTHTHQ AESTEASGQT QTSEPASSGS
810 820 830 840 850
RTTSAGTATP SSSGASGTTP SGSEGISTSG ETTRFSSNPS RDSHTTQSTT
860 870 880 890 900
ELLSASASHG AIPVSTGMAS SIVPGTFHPT LSEASTAGRP TGQSSPTSPS
910 920 930 940 950
ASPQETAAIS RMAQTQRTGT SRGSDTISLA SQATDTFSTV PPTPPSITSS
960 970 980 990 1000
GLTSPQTQTH TLSPSGSGKT FTTALISNAT PLPVTSTSSA STGHATPLAV
1010 1020 1030 1040 1050
SSATSASTVS SDSPLKMETS GMTTPSLKTD GGRRTATSPP PTTSQTIIST
1060 1070 1080 1090 1100
IPSTAMHTRS TAAPIPILPE RGVSLFPYGA GAGDLEFVRR TVDFTSPLFK
1110 1120 1130 1140 1150
PATGFPLGSS LRDSLYFTDN GQIIFPESDY QIFSYPNPLP TGFTGRDPVA
1160 1170 1180 1190 1200
LVAPFWDDAD FSTGRGTTFY QEYETFYGEH SLLVQQAESW IRKMTNNGGY
1210 1220 1230 1240 1250
KARWALKVTW VNAHAYPAQW TLGSNTYQAI LSTDGSRSYA LFLYQSGGMQ
1260 1270 1280 1290 1300
WDVAQRSGNP VLMGFSSGDG YFENSPLMSQ PVWERYRPDR FLNSNSGLQG
1310 1320 1330 1340 1350
LQFYRLHREE RPNYRLECLQ WLKSQPRWPS WGWNQVSCPC SWQQGRRDLR
1360 1370 1380 1390 1400
FQPVSIGRWG LGSRQLCSFT SWRGGVCCSY GPWGEFREGW HVQRPWQLAQ
1410 1420 1430 1440 1450
ELEPQSWCCR WNDKPYLCAL YQQRRPHVGC ATYRPPQPAW MFGDPHITTL
1460 1470 1480 1490 1500
DGVSYTFNGL GDFLLVGAQD GNSSFLLQGR TAQTGSAQAT NFIAFAAQYR
1510 1520 1530 1540 1550
SSSLGPVTVQ WLLEPHDAIR VLLDNQTVTF QPDHEDGGGQ ETFNATGVLL
1560 1570 1580 1590 1600
SRNGSEVSAS FDGWATVSVI ALSNILHASA SLPPEYQNRT EGLLGVWNNN
1610 1620 1630 1640 1650
PEDDFRMPNG STIPPGSPEE MLFHFGMTWQ INGTGLLGKR NDQLPSNFTP
1660 1670 1680 1690 1700
VFYSQLQKNS SWAEHLISNC DGDSSCIYDT LALRNASIGL HTREVSKNYE
1710 1720 1730 1740 1750
QANATLNQYP PSINGGRVIE AYKGQTTLIQ YTSNAEDANF TLRDSCTDLE
1760 1770 1780 1790 1800
LFENGTLLWT PKSLEPFTLE ILARSAKIGL ASALQPRTVV CHCNAESQCL
1810 1820 1830 1840 1850
YNQTSRVGNS SLEVAGCKCD GGTFGRYCEG SEDACEEPCF PSVHCVPGKG
1860 1870 1880 1890 1900
CEACPPNLTG DGRHCAALGS SFLCQNQSCP VNYCYNQGHC YISQTLGCQP
1910 1920 1930 1940 1950
MCTCPPAFTD SRCFLAGNNF SPTVNLELPL RVIQLLLSEE ENASMAEVNA
1960 1970 1980 1990 2000
SVAYRLGTLD MRAFLRNSQV ERIDSAAPAS GSPIQHWMVI SEFQYRPRGP
2010 2020 2030 2040 2050
VIDFLNNQLL AAVVEAFLYH VPRRSEEPRN DVVFQPISGE DVRDVTALNV
2060 2070 2080 2090 2100
STLKAYFRCD GYKGYDLVYS PQSGFTCVSP CSRGYCDHGG QCQHLPSGPR
2110 2120 2130 2140 2150
CSCVSFSIYT AWGEHCEHLS MKLDAFFGIF FGALGGLLLL GVGTFVVLRF
2160
WGCSGARFSY FLNSAEALP
Length:2,169
Mass (Da):231,518
Last modified:June 28, 2011 - v4
Checksum:i53615AF8DD416957
GO
Isoform 2 (identifier: Q99102-2) [UniParc]FASTAAdd to basket
Also known as: Sv12, Sv13

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1157: FTDNGQIIFP...PVALVAPFWD → ASQAGTLWPW...TRRSMVNTAC
     1158-2169: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,157
Mass (Da):118,842
Checksum:i563F538E94C8D17F
GO
Isoform 3 (identifier: Q99102-3) [UniParc]FASTAAdd to basket
Also known as: Sv20

The sequence of this isoform differs from the canonical sequence as follows:
     1814-1827: VAGCKCDGGTFGRY → LWGALSCVRTSPAL
     1828-2169: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,827
Mass (Da):194,147
Checksum:i7C0F057C7FFD9B61
GO
Isoform 5 (identifier: Q99102-5) [UniParc]FASTAAdd to basket
Also known as: Sv18, Sv19

The sequence of this isoform differs from the canonical sequence as follows:
     1172-1223: Missing.
     1258-1267: GNPVLMGFSS → VEMAFSKTAH
     1268-2169: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,215
Mass (Da):125,352
Checksum:i6394DD971A6AC6AA
GO
Isoform 7 (identifier: Q99102-7) [UniParc]FASTAAdd to basket
Also known as: Sv16

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1201: FTDNGQIIFP...RKMTNNGGYK → ASQAGTLWPW...VPASVGEVSP
     1202-2169: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,201
Mass (Da):123,420
Checksum:i90CCFA911DF8A6DC
GO
Isoform 8 (identifier: Q99102-8) [UniParc]FASTAAdd to basket
Also known as: Sv15

The sequence of this isoform differs from the canonical sequence as follows:
     1117-1199: FTDNGQIIFP...WIRKMTNNGG → ASQAGTLWPW...VEMAFSKTAH
     1200-2169: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,199
Mass (Da):123,047
Checksum:iC297274BF47EE49E
GO
Isoform 9 (identifier: Q99102-9) [UniParc]FASTAAdd to basket
Also known as: Sv11

The sequence of this isoform differs from the canonical sequence as follows:
     1071-1107: RGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPL → SPLWGRRRGPGVRQEDRGLHLPTLQAGDWLPP
     1108-2169: Missing.

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:1,102
Mass (Da):112,954
Checksum:iA533603C2182BFD7
GO
Isoform 10 (identifier: Q99102-10) [UniParc]FASTAAdd to basket
Also known as: Sv3, Sv17

The sequence of this isoform differs from the canonical sequence as follows:
     1172-1223: Missing.

Show »
Length:2,117
Mass (Da):225,434
Checksum:i6A59FC9B7497C05F
GO
Isoform 11 (identifier: Q99102-11) [UniParc]FASTAAdd to basket
Also known as: Sv2

The sequence of this isoform differs from the canonical sequence as follows:
     1073-1187: VSLFPYGAGA...GEHSLLVQQA → EAIQEFPSSP...TRRSMVNTAC
     1188-2169: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,187
Mass (Da):121,900
Checksum:i79896412E450E46B
GO
Isoform 12 (identifier: Q99102-12) [UniParc]FASTAAdd to basket
Also known as: SvX

The sequence of this isoform differs from the canonical sequence as follows:
     29-1072: Missing.

Note: May be preferentially expressed in tumor tissues.
Show »
Length:1,125
Mass (Da):125,130
Checksum:iD1750D4908B75B6D
GO
Isoform 13 (identifier: Q99102-13) [UniParc]FASTAAdd to basket
Also known as: SvY

The sequence of this isoform differs from the canonical sequence as follows:
     29-1021: Missing.

Note: May be preferentially expressed in tumor tissues.
Show »
Length:1,176
Mass (Da):130,415
Checksum:i92B845E20A242187
GO
Isoform 15 (identifier: Q99102-15) [UniParc]FASTAAdd to basket
Also known as: Sv1

The sequence of this isoform differs from the canonical sequence as follows:
     1073-1177: VSLFPYGAGA...TFYQEYETFY → AIQEFPSSPM...LVGGPHFIRL
     1178-2169: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,176
Mass (Da):120,650
Checksum:i922532E6C031907A
GO
Isoform 16 (identifier: Q99102-16) [UniParc]FASTAAdd to basket
Also known as: Sv6

The sequence of this isoform differs from the canonical sequence as follows:
     1336-1384: VSCPCSWQQG...GVCCSYGPWG → AAPPRLAQPR...QSVSCWITRL
     1385-2169: Missing.

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:1,384
Mass (Da):144,847
Checksum:i24DAF864CC4008DD
GO
Isoform 17 (identifier: Q99102-17) [UniParc]FASTAAdd to basket
Also known as: Sv8

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1579: Missing.

Note: Dubious isoform produced through aberrant splice sites.
Show »
Length:1,943
Mass (Da):206,605
Checksum:i8AB442BDDA613D41
GO

Computationally mapped potential isoform sequencesi

There are 55 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PDY6E9PDY6_HUMAN
Mucin-4
MUC4
5,412Annotation score:
E7ENC5E7ENC5_HUMAN
Mucin-4
MUC4
5,360Annotation score:
A0A0G2JS65A0A0G2JS65_HUMAN
Mucin-4
MUC4
7,418Annotation score:
A0A0G2JR97A0A0G2JR97_HUMAN
Mucin-4
MUC4
7,366Annotation score:
A0A0G2JSC3A0A0G2JSC3_HUMAN
Mucin-4
MUC4
1,176Annotation score:
A0A0G2JRU8A0A0G2JRU8_HUMAN
Mucin-4
MUC4
1,125Annotation score:
A0A0G2JRA1A0A0G2JRA1_HUMAN
Mucin-4
MUC4
5,386Annotation score:
A0A0G2JSB1A0A0G2JSB1_HUMAN
Mucin-4
MUC4
1,098Annotation score:
A0A0G2JM16A0A0G2JM16_HUMAN
Mucin-4
MUC4
5,314Annotation score:
A0A0G2JQJ2A0A0G2JQJ2_HUMAN
Mucin-4
MUC4
1,149Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence AAA63230 differs from that shown. May be derived from an intron translation.Curated
The sequence CAC14139 differs from that shown. Reason: Frameshift at position 1171.Curated
The sequence CAC14141 differs from that shown. Reason: Frameshift at position 1256.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1194M → I in CAB85602 (PubMed:10880978).Curated1
Sequence conflicti1194M → I in CAB85603 (PubMed:10880978).Curated1
Sequence conflicti1194M → I in CAB85604 (PubMed:10880978).Curated1
Sequence conflicti1194M → I in CAB85605 (PubMed:10880978).Curated1
Sequence conflicti1194M → I in CAB85606 (PubMed:10880978).Curated1
Sequence conflicti1194M → I in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti1194M → I in CAC14141 (PubMed:10920259).Curated1
Sequence conflicti1194M → I in CAC14142 (PubMed:10920259).Curated1
Sequence conflicti1194M → I in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti1194M → I in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti1194M → I in CAD22550 (PubMed:10024507).Curated1
Sequence conflicti1194M → I in CAB38059 (PubMed:12153560).Curated1
Sequence conflicti1259N → K in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti1259N → K in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti1259N → K in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti1259N → K in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti1271Y → F in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti1271Y → F in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti1271Y → F in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti1271Y → F in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti1305R → G in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti1305R → G in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti1305R → G in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti1305R → G in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti1557V → A in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti1557V → A in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti1557V → A in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti1557V → A in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti1920 – 1921Missing in CAC14143 (PubMed:10920259).Curated2
Sequence conflicti2039G → E in CAB85604 (PubMed:10880978).Curated1
Sequence conflicti2039G → E in CAB85605 (PubMed:10880978).Curated1
Sequence conflicti2039G → E in CAB85606 (PubMed:10880978).Curated1
Sequence conflicti2039G → E in CAD22550 (PubMed:10024507).Curated1
Sequence conflicti2039G → E in CAB38059 (PubMed:12153560).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03021137G → D. Corresponds to variant dbSNP:rs2259292Ensembl.1
Natural variantiVAR_06526141A → P2 PublicationsCorresponds to variant dbSNP:rs3107764Ensembl.1
Natural variantiVAR_030212161T → A. Corresponds to variant dbSNP:rs2293232Ensembl.1
Natural variantiVAR_030213585S → A. Corresponds to variant dbSNP:rs2246901Ensembl.1
Natural variantiVAR_056585721A → T. Corresponds to variant dbSNP:rs3749331Ensembl.1
Natural variantiVAR_0652621081G → D5 PublicationsCorresponds to variant dbSNP:rs2259292Ensembl.1
Natural variantiVAR_0565861205A → T. Corresponds to variant dbSNP:rs2293232Ensembl.1
Natural variantiVAR_0565871578A → S1 PublicationCorresponds to variant dbSNP:rs2246901Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02265029 – 1072Missing in isoform 12. 1 PublicationAdd BLAST1044
Alternative sequenceiVSP_02265129 – 1021Missing in isoform 13. 1 PublicationAdd BLAST993
Alternative sequenceiVSP_0226521071 – 1107RGVSL…TGFPL → SPLWGRRRGPGVRQEDRGLH LPTLQAGDWLPP in isoform 9. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0226531073 – 1187VSLFP…LVQQA → EAIQEFPSSPMGQTPGTWSS SGGPWTSPPHSSSRRLASPL APLSVIPSTSQTMARSSSQS QTTRFSPTPTHSQQASQAGT LWPWWLRSGTMLTSPLVGGP HFIRNTRRSMVNTAC in isoform 11. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_0226541073 – 1177VSLFP…YETFY → AIQEFPSSPMGQTPGTWSSS GGPWTSPPHSSSRRLASPLA PLSVIPSTSQTMARSSSQSQ TTRFSPTPTHSQQASQAGTL WPWWLRSGTMLTSPLVGGPH FIRL in isoform 15. CuratedAdd BLAST105
Alternative sequenceiVSP_0226551108 – 2169Missing in isoform 9. 1 PublicationAdd BLAST1062
Alternative sequenceiVSP_0226561117 – 1201FTDNG…NGGYK → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQWRWLFRKQPTDVPASV GEVSP in isoform 7. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_0226571117 – 1199FTDNG…TNNGG → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQASRCSWASLVEMAFSK TAH in isoform 8. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_0226581117 – 1157FTDNG…APFWD → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRNTRRSMVNTA C in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_0226591158 – 2169Missing in isoform 2. 1 PublicationAdd BLAST1012
Alternative sequenceiVSP_0226611172 – 1223Missing in isoform 5 and isoform 10. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_0226621178 – 2169Missing in isoform 15. CuratedAdd BLAST992
Alternative sequenceiVSP_0226631188 – 2169Missing in isoform 11. 1 PublicationAdd BLAST982
Alternative sequenceiVSP_0226641200 – 2169Missing in isoform 8. 1 PublicationAdd BLAST970
Alternative sequenceiVSP_0226651202 – 2169Missing in isoform 7. 1 PublicationAdd BLAST968
Alternative sequenceiVSP_0226691258 – 1267GNPVLMGFSS → VEMAFSKTAH in isoform 5. 1 Publication10
Alternative sequenceiVSP_0226701268 – 2169Missing in isoform 5. 1 PublicationAdd BLAST902
Alternative sequenceiVSP_0226711336 – 1384VSCPC…YGPWG → AAPPRLAQPRPPTSSPLRLS TAPAAWAPSRSNGSLSLTTQ SVSCWITRL in isoform 16. CuratedAdd BLAST49
Alternative sequenceiVSP_0226721354 – 1579Missing in isoform 17. CuratedAdd BLAST226
Alternative sequenceiVSP_0226731385 – 2169Missing in isoform 16. CuratedAdd BLAST785
Alternative sequenceiVSP_0226741814 – 1827VAGCK…TFGRY → LWGALSCVRTSPAL in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_0226751828 – 2169Missing in isoform 3. 1 PublicationAdd BLAST342

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242541 mRNA Translation: CAB85597.1
AJ242542 mRNA Translation: CAB85598.1
AJ242543 mRNA Translation: CAB85599.1
AJ242544 mRNA Translation: CAB85600.1
AJ242545 mRNA Translation: CAB85601.1
AJ242546 mRNA Translation: CAB85602.1
AJ242547 mRNA Translation: CAB85603.1
AJ242548 mRNA Translation: CAB85604.1
AJ242549 mRNA Translation: CAB85605.1
AJ242550 mRNA Translation: CAB85606.1
AJ276359 mRNA Translation: CAB81773.1
AJ277412 mRNA Translation: CAC10061.1
AJ277505 mRNA Translation: CAC14585.1
AJ400633 mRNA Translation: CAC10062.1
AJ400849 mRNA Translation: CAC14134.1
AJ400850 mRNA Translation: CAC14135.1
AJ400851 mRNA Translation: CAC14136.1
AJ400852 mRNA Translation: CAC14137.1
AJ400855 mRNA Translation: CAC14140.1
AJ400853 mRNA Translation: CAC14138.1
AJ400854 mRNA Translation: CAC14139.1 Frameshift.
AJ400856 mRNA Translation: CAC14141.1 Frameshift.
AJ400857 mRNA Translation: CAC14142.1
AJ400858 mRNA Translation: CAC14143.1
AF522055
, AF522031, AF522032, AF522033, AF522034, AF522035, AF522036, AF522037, AF522038, AF522039, AF522040, AF522041, AF522042, AF522043, AF522044, AF522045, AF522046, AF522047, AF522048, AF522049, AF522050, AF522051, AF522052, AF522053, AF522054 Genomic DNA Translation: AAM66747.1
AJ010901 mRNA Translation: CAB38059.1
AJ430032, AJ430033, AJ430034 Genomic DNA Translation: CAD22550.1
M64594 mRNA Translation: AAA63230.1 Sequence problems.
AC069513 Genomic DNA No translation available.
AC233280 Genomic DNA No translation available.
CCDSiCCDS3310.1 [Q99102-13]
CCDS3311.1 [Q99102-12]
PIRiPN0012
RefSeqiNP_004523.3, NM_004532.5 [Q99102-13]
NP_060876.5, NM_018406.6
NP_612154.2, NM_138297.4 [Q99102-12]
UniGeneiHs.369646

Genome annotation databases

EnsembliENST00000346145; ENSP00000304207; ENSG00000145113 [Q99102-13]
ENST00000349607; ENSP00000338109; ENSG00000145113 [Q99102-12]
GeneIDi4585
KEGGihsa:4585
UCSCiuc003fvo.5 human [Q99102-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Mucin database
Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242541 mRNA Translation: CAB85597.1
AJ242542 mRNA Translation: CAB85598.1
AJ242543 mRNA Translation: CAB85599.1
AJ242544 mRNA Translation: CAB85600.1
AJ242545 mRNA Translation: CAB85601.1
AJ242546 mRNA Translation: CAB85602.1
AJ242547 mRNA Translation: CAB85603.1
AJ242548 mRNA Translation: CAB85604.1
AJ242549 mRNA Translation: CAB85605.1
AJ242550 mRNA Translation: CAB85606.1
AJ276359 mRNA Translation: CAB81773.1
AJ277412 mRNA Translation: CAC10061.1
AJ277505 mRNA Translation: CAC14585.1
AJ400633 mRNA Translation: CAC10062.1
AJ400849 mRNA Translation: CAC14134.1
AJ400850 mRNA Translation: CAC14135.1
AJ400851 mRNA Translation: CAC14136.1
AJ400852 mRNA Translation: CAC14137.1
AJ400855 mRNA Translation: CAC14140.1
AJ400853 mRNA Translation: CAC14138.1
AJ400854 mRNA Translation: CAC14139.1 Frameshift.
AJ400856 mRNA Translation: CAC14141.1 Frameshift.
AJ400857 mRNA Translation: CAC14142.1
AJ400858 mRNA Translation: CAC14143.1
AF522055
, AF522031, AF522032, AF522033, AF522034, AF522035, AF522036, AF522037, AF522038, AF522039, AF522040, AF522041, AF522042, AF522043, AF522044, AF522045, AF522046, AF522047, AF522048, AF522049, AF522050, AF522051, AF522052, AF522053, AF522054 Genomic DNA Translation: AAM66747.1
AJ010901 mRNA Translation: CAB38059.1
AJ430032, AJ430033, AJ430034 Genomic DNA Translation: CAD22550.1
M64594 mRNA Translation: AAA63230.1 Sequence problems.
AC069513 Genomic DNA No translation available.
AC233280 Genomic DNA No translation available.
CCDSiCCDS3310.1 [Q99102-13]
CCDS3311.1 [Q99102-12]
PIRiPN0012
RefSeqiNP_004523.3, NM_004532.5 [Q99102-13]
NP_060876.5, NM_018406.6
NP_612154.2, NM_138297.4 [Q99102-12]
UniGeneiHs.369646

3D structure databases

SMRiQ99102
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ99102, 1 interactor
STRINGi9606.ENSP00000417498

PTM databases

GlyConnecti374
iPTMnetiQ99102
PhosphoSitePlusiQ99102
UniCarbKBiQ99102

Polymorphism and mutation databases

BioMutaiMUC4
DMDMi338817990

Proteomic databases

MaxQBiQ99102
PaxDbiQ99102
PeptideAtlasiQ99102
PRIDEiQ99102
ProteomicsDBi78234
78235 [Q99102-10]
78236 [Q99102-11]
78237 [Q99102-12]
78238 [Q99102-13]
78239 [Q99102-15]
78240 [Q99102-16]
78241 [Q99102-17]
78242 [Q99102-2]
78243 [Q99102-3]
78244 [Q99102-5]
78245 [Q99102-7]
78246 [Q99102-8]
78247 [Q99102-9]
TopDownProteomicsiQ99102-3 [Q99102-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000346145; ENSP00000304207; ENSG00000145113 [Q99102-13]
ENST00000349607; ENSP00000338109; ENSG00000145113 [Q99102-12]
GeneIDi4585
KEGGihsa:4585
UCSCiuc003fvo.5 human [Q99102-1]

Organism-specific databases

CTDi4585
DisGeNETi4585
EuPathDBiHostDB:ENSG00000145113.21
GeneCardsiMUC4
H-InvDBiHIX0003957
HIX0163449
HGNCiHGNC:7514 MUC4
HPAiCAB013536
HPA005895
MIMi158372 gene
neXtProtiNX_Q99102
OpenTargetsiENSG00000145113
PharmGKBiPA31319
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHUZ Eukaryota
ENOG4111F6U LUCA
GeneTreeiENSGT00730000110943
HOVERGENiHBG081997
InParanoidiQ99102
KOiK22017

Enzyme and pathway databases

ReactomeiR-HSA-5083625 Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
R-HSA-5083632 Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
R-HSA-5083636 Defective GALNT12 causes colorectal cancer 1 (CRCS1)
R-HSA-5621480 Dectin-2 family
R-HSA-913709 O-linked glycosylation of mucins
R-HSA-977068 Termination of O-glycan biosynthesis
SIGNORiQ99102

Miscellaneous databases

ChiTaRSiMUC4 human
GeneWikiiMUC4
GenomeRNAii4585
PROiPR:Q99102
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000145113 Expressed in 134 organ(s), highest expression level in nasal cavity epithelium
ExpressionAtlasiQ99102 baseline and differential
GenevisibleiQ99102 HS

Family and domain databases

InterProiView protein in InterPro
IPR005533 AMOP_dom
IPR000742 EGF-like_dom
IPR003886 NIDO_dom
IPR001846 VWF_type-D
PfamiView protein in Pfam
PF06119 NIDO, 1 hit
PF00094 VWD, 1 hit
SMARTiView protein in SMART
SM00723 AMOP, 1 hit
SM00181 EGF, 3 hits
SM00539 NIDO, 1 hit
SM00216 VWD, 1 hit
PROSITEiView protein in PROSITE
PS50856 AMOP, 1 hit
PS00022 EGF_1, 1 hit
PS50026 EGF_3, 2 hits
PS51220 NIDO, 1 hit
PS51233 VWFD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMUC4_HUMAN
AccessioniPrimary (citable) accession number: Q99102
Secondary accession number(s): O95938
, Q9GZM2, Q9GZV6, Q9H481, Q9H482, Q9H483, Q9H484, Q9H485, Q9H486, Q9H487, Q9H4D6, Q9H4D8, Q9NPJ0, Q9NY09, Q9NY75, Q9NY76, Q9NY77, Q9NY78, Q9NY79, Q9NY80, Q9NY81
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 1, 1994
Last sequence update: June 28, 2011
Last modified: September 12, 2018
This is version 147 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again