Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 167 (25 May 2022)
Sequence version 5 (29 Sep 2021)
Previous versions | rss
Add a publicationFeedback
Protein

Mucin-4

Gene

MUC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Membrane-bound mucin, a family of highly glycosylated proteins that constitute the major component of the mucus, the slimy and viscous secretion covering epithelial surfaces (PubMed:10880978).

These glycoproteins play important roles in the protection of the epithelium and are implicated in epithelial renewal and differentiation (PubMed:10880978).

Regulates cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and its ability to act as an intramembrane ligand for ERBB2. Plays an important role in proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. In polarized epithelial cells, segregates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Its ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation.

1 Publication4 Publications

Miscellaneous

Expression is a very useful predictor of poor prognosis in patients with invasive ductal carcinoma and intrahepatic cholangiocarcinoma, mass forming type (IDC,ICC-MF). Patients with IDC or ICC-MF who have high MUC4 expression had a worse survival rate than those with low MUC4 expression.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q99102

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5083625, Defective GALNT3 causes HFTC
R-HSA-5083632, Defective C1GALT1C1 causes TNPS
R-HSA-5083636, Defective GALNT12 causes CRCS1
R-HSA-5621480, Dectin-2 family
R-HSA-913709, O-linked glycosylation of mucins
R-HSA-977068, Termination of O-glycan biosynthesis

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q99102

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q99102

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mucin-4
Short name:
MUC-4
Alternative name(s):
Ascites sialoglycoprotein
Short name:
ASGP
Pancreatic adenocarcinoma mucin
Testis mucin
Tracheobronchial mucin
Cleaved into the following 2 chains:
Alternative name(s):
Ascites sialoglycoprotein 1
Short name:
ASGP-1
Alternative name(s):
Ascites sialoglycoprotein 2
Short name:
ASGP-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MUC4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7514, MUC4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
158372, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q99102

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000145113

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei5369 – 5389HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
4585

Open Targets

More...
OpenTargetsi
ENSG00000145113

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31319

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q99102, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MUC4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
338817990

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 28Sequence analysisAdd BLAST28
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000015895629 – 5412Mucin-4Add BLAST5384
ChainiPRO_000027422529 – 4687Mucin-4 alpha chain1 PublicationAdd BLAST4659
ChainiPRO_00002742264688 – 5412Mucin-4 beta chain1 PublicationAdd BLAST725

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi154O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi156O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi230N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi234O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi255N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi364O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi369O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi376O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi617N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi620O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi666O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi688O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi747O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi797O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi798O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi802O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi804O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi813O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi814O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi881O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi886O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi892O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi931O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi934O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi938O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi943O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi945O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi948O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi952O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi954O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1003O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1007O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1012O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1019O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1022O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1023O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1028O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1030O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1035O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1039O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1044O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1051O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1055O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1060O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1062O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1067O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1071O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1076O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1083O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1086O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1087O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1092O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1094O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1099O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1103O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1108O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1110O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1115O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1118O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1119O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1124O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1126O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1131O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1135O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1172O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1179O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1182O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1183O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1188O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1195O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1199O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1204O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1236O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1243O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1246O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1247O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1278O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1279O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1284O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1286O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1291O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1295O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1300O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1307O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1311O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1316O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1323O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1326O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1332O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1339O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1342O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1343O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1348O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1380O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1387O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1390O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1391O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1396O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1403O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1407O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1412O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1444O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1451O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1454O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1455O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1486O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1487O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1492O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1494O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1499O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1503O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1508O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1515O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1519O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1524O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1531O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1534O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1540O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1547O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1550O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1551O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1556O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1563O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1566O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1567O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1572O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1579O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1582O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1583O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1588O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1590O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1598O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1599O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1604O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1611O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1614O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1615O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1620O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1622O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1627O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1630O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1637N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi1659O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1663O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1668O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1670O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1675O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1679O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1716O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1723O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1726O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1727O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1732O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1764O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1766O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1812O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1819O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1822O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1823O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1828O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1835O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1838O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1839O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1844O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1854O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1855O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1931O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1934O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1935O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1940O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1950O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1951O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1956O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1963O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1995O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi1999O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2004O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2006O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2015O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2020O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2027O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2030O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2031O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2036O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2038O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2047O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2052O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2062O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2063O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2132O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2137O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2139O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2142O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2143O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2148O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2150O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2155O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2159O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2164O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2180O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2182O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2187O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2191O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2196O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2198O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2203O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2207O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2244O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2254O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2255O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2283O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2286O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2287O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2292O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2299O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2303O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2308O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2324O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2331O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2334O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2335O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2340O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2347O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2351O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2356O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2363O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2366O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2367O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2372O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2382O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2383O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2388O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2395O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2398O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2399O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2406O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2437N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi2452O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2454O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2459O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2462O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2463O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2468O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2500O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2507O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2510O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2511O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2516O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2518O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2523O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2526O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2533N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi2564O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2566O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2571O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2575O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2580O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2582O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2587O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2590O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2591O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2596O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2598O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2619O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2622O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2623O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2628O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2660O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2667O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2670O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2671O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2676O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2683O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2687O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2692O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2694O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2740O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2742O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2750O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2751O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2756O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2758O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2763O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2767O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2773N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi2779O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2783O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2788O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2795O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2798O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2799O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2804O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2846O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2847O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2852O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2910O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2911O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2916O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2918O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2923O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2927O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2932O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2939O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2942O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2943O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2948O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2950O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2955O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2959O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2966O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2971O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi2975O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3023O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3028O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3035O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3039O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3071O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3076O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3078O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3083O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3087O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3092O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3099O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3102O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3103O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3108O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3115O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3118O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3119O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3124O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3126O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3131O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3135O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3140O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3142O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3147O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3150O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3151O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3156O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3158O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3163O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3167O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3172O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3179O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3182O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3183O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3188O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3220O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3227O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3230O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3231O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3236O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3243O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3247O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3252O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3254O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3294O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3332O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3339O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3342O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3343O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3348O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3350O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3355O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3359O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3397N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi3398O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3403O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3406O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3412O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3419O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3423O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3428O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3430O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3435O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3439O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3444O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3445O-linked (GalNAc...) serineSequence analysis1
Glycosylationi3446O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3451O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3454O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3455O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3460O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3462O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3467O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3470O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3471O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3476O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3483O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3486O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3487O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3492O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3499O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3502O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3504O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3508O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3515O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3519O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3524O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3526O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3531O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3535O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3540O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3547O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3550O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3551O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3556O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3567O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3614O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3615O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3622O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3678O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3679O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3686O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3691O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3695O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3700O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3710O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3711O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3716O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3718O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3723O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3727O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3732O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3739O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3743O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3748O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3780O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3787O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3790O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3791O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3796O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3798O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3803O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3807O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3812O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3822O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3823O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3828O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3835O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3839O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3844O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3851O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3854O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3860O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3867O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3871O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3876O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3883O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3886O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3887O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3892O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3894O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3899O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3903O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3935O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3940O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3942O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3947O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3950O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3951O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3956O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3958O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3963O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3967O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3972O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3979O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3983O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3988O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3990O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3995O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi3999O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4004O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4006O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4011O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4015O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4020O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4021O-linked (GalNAc...) serineSequence analysis1
Glycosylationi4023O-linked (GalNAc...) serineSequence analysis1
Glycosylationi4024O-linked (GalNAc...) serineSequence analysis1
Glycosylationi4026O-linked (GalNAc...) serineSequence analysis1
Glycosylationi4027O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4031O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4036O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4037O-linked (GalNAc...) serineSequence analysis1
Glycosylationi4038O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4043O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4046O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4047O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4053N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4078O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4084O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4110O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4111O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4116O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4118O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4123O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4127O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4132O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4139O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4142O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4143O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4148O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4158O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4159O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4164O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4171O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4175O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4180O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4182O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4187O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4190O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4191O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4196O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4198O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4203O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4207O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4212O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4214O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4219O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4223O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4239O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4272O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4278O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4280O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4289O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4293O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4297O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi4715N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4768N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4787N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4796N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4831N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4852N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4875N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4902N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4928N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4946N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4982N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi4997N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi5045N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi5052N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi5100N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi5119N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi5122 ↔ 5133PROSITE-ProRule annotation
Disulfide bondi5127 ↔ 5145PROSITE-ProRule annotation
Disulfide bondi5147 ↔ 5156PROSITE-ProRule annotation
Glycosylationi5185N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi5192N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Glycosylationi5292N-linked (GlcNAc...) asparaginePROSITE-ProRule annotation1
Disulfide bondi5324 ↔ 5335PROSITE-ProRule annotation
Disulfide bondi5329 ↔ 5344PROSITE-ProRule annotation
Disulfide bondi5346 ↔ 5359PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically cleaved into 2 chains, mucin-4 alpha chain and mucin-4 beta chain.1 Publication
Highly O-glycosylated.1 Publication
Is predominantly N-glycosylated.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei4687 – 4688Cleavage1 Publication2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q99102

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q99102

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q99102

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q99102

PeptideAtlas

More...
PeptideAtlasi
Q99102

PRoteomics IDEntifications database

More...
PRIDEi
Q99102

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
78234 [Q99102-1]
78235 [Q99102-10]
78236 [Q99102-11]
78237 [Q99102-12]
78238 [Q99102-13]
78239 [Q99102-15]
78240 [Q99102-16]
78241 [Q99102-17]
78242 [Q99102-2]
78243 [Q99102-3]
78244 [Q99102-5]
78245 [Q99102-7]
78246 [Q99102-8]
78247 [Q99102-9]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q99102-3 [Q99102-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
374, 7 N-Linked glycans (3 sites), 8 O-Linked glycans

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q99102, 25 sites, 9 N-linked glycans (3 sites), 15 O-linked glycans (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q99102

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q99102

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, squamous cell carcinomas of the upper aerodigestive tract, mammary carcinomas, biliary tract, colon, and cervix cancers. Minimally or not expressed in the normal pancreas or chronic pancreatitis, but is highly expressed in pancreatic tumors and pancreatic tumor cell lines.4 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed early in the primitive gut before respiratory and digestive epithelial cells have acquired their tissue and cell specificity. Expressed at the basal surface of the epithelium from week 14 to 26 weeks and then predominantly localized in only parietal cells. Immediately before birth, found in the cytoplasm of the mucous columnar epithelial cells. In the embryo expressed in skin, then disappears late in gestation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000145113, Expressed in nasal cavity epithelium and 155 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q99102, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q99102, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000145113, Tissue enhanced (esophagus, intestine, prostate, vagina)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

A heterodimeric complex, composed of a mucin-4 alpha chain and a cysteine-rich transmembrane mucin-4 beta chain. Mucin-4 beta chain interacts with ERBB2 via the EGF-like domain 1. In nonpolarized cells, associates with ERBB2 and ERBB3.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
110672, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q99102, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000417498

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q99102, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

AlphaFold Protein Structure Database

More...
AlphaFoldDBi
Q99102

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4397 – 4552NIDOPROSITE-ProRule annotationAdd BLAST156
Domaini4553 – 4668AMOPPROSITE-ProRule annotationAdd BLAST116
Domaini4680 – 4880VWFDPROSITE-ProRule annotationAdd BLAST201
Domaini5118 – 5157EGF-like 1PROSITE-ProRule annotationAdd BLAST40
Domaini5321 – 5360EGF-like 2PROSITE-ProRule annotationAdd BLAST40

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni40 – 87DisorderedSequence analysisAdd BLAST48
Regioni43 – 4241Variable number of tandem repeats (VNTR)1 PublicationAdd BLAST4199
Regioni142 – 249DisorderedSequence analysisAdd BLAST108
Regioni267 – 286DisorderedSequence analysisAdd BLAST20
Regioni303 – 328DisorderedSequence analysisAdd BLAST26
Regioni353 – 383DisorderedSequence analysisAdd BLAST31
Regioni438 – 473DisorderedSequence analysisAdd BLAST36
Regioni488 – 580DisorderedSequence analysisAdd BLAST93
Regioni592 – 853DisorderedSequence analysisAdd BLAST262
Regioni868 – 963DisorderedSequence analysisAdd BLAST96
Regioni983 – 1864DisorderedSequence analysisAdd BLAST882
Regioni1878 – 2078DisorderedSequence analysisAdd BLAST201
Regioni2111 – 2220DisorderedSequence analysisAdd BLAST110
Regioni2232 – 2814DisorderedSequence analysisAdd BLAST583
Regioni2837 – 3306DisorderedSequence analysisAdd BLAST470
Regioni3320 – 3580DisorderedSequence analysisAdd BLAST261
Regioni3592 – 3644DisorderedSequence analysisAdd BLAST53
Regioni3656 – 3756DisorderedSequence analysisAdd BLAST101
Regioni3769 – 4223DisorderedSequence analysisAdd BLAST455
Regioni4242 – 4288DisorderedSequence analysisAdd BLAST47

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi304 – 328Polar residuesSequence analysisAdd BLAST25
Compositional biasi488 – 530Polar residuesSequence analysisAdd BLAST43
Compositional biasi543 – 580Polar residuesSequence analysisAdd BLAST38

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Essentially composed of an array of serine- and threonine-rich tandem repeats which is highly polymorphic, the variable number of tandem repeats (VNTR) region.1 Publication

Keywords - Domaini

EGF-like domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QUJ0, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000110943

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001484_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q99102

Database of Orthologous Groups

More...
OrthoDBi
668024at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005533, AMOP_dom
IPR000742, EGF-like_dom
IPR003886, NIDO_dom
IPR001846, VWF_type-D

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06119, NIDO, 1 hit
PF00094, VWD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00723, AMOP, 1 hit
SM00181, EGF, 3 hits
SM00539, NIDO, 1 hit
SM00216, VWD, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50856, AMOP, 1 hit
PS00022, EGF_1, 1 hit
PS50026, EGF_3, 2 hits
PS51220, NIDO, 1 hit
PS51233, VWFD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (14+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 14 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms exist.

This entry has 14 described isoforms and 55 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99102-1) [UniParc]FASTAAdd to basket
Also known as: Sv0-MUC41 Publication, Sv211 Publication

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKGARWRRVP WVSLSCLCLC LLPHVVPGTT EDTLITGSKT AAPVTSTGST
60 70 80 90 100
TATLEGQSTA ASSRTSNQDI SASSQNHQTK STETTSKAQT DTLTQMMTST
110 120 130 140 150
LFSSPSVHNV METAPPDEMT TSFPSSVTNT LMMTSKTITM TTSTDSTLGN
160 170 180 190 200
TEETSTAGTE SSTPVTSAVS ITAGQEGQSR TTSWRTSIQD TSASSQNHWT
210 220 230 240 250
RSTQTTRESQ TSTLTHRTTS TPSFSPSVHN VTGTVSQKTS PSGETATSSL
260 270 280 290 300
CSVTNTSMMT SEKITVTTST GSTLGNPGET SSVPVTGSLM PVTSAALVTF
310 320 330 340 350
DPEGQSPATF SRTSTQDTTA FSKNHQTQSV ETTRVSQINT LNTLTPVTTS
360 370 380 390 400
TVLSSPSGFN PSGTVSQETF PSGETTTSSP SSVSNTFLVT SKVFRMPTSR
410 420 430 440 450
DSTLGNTEET SLSVSGTISA ITSKVSTIWW SDTLSTALSP SSLPPKISTA
460 470 480 490 500
FHTQQSEGAE TTGRPHERSS FSPGVSQEIF TLHETTTWPS SFSSKGHTTW
510 520 530 540 550
SQTELPSTST GAATRLVTGN PSTGTAGTIP RVPSKVSAIG EPGEPTTYSS
560 570 580 590 600
HSTTLPKTTG AGAQTQWTQE TGTTGEALLS SPSYSVTQMI KTATSPSSSP
610 620 630 640 650
MLDRHTSQQI TTAPSTNHST IHSTSTSPQE SPAVSQRGHT QAPQTTQESQ
660 670 680 690 700
TTRSVSPMTD TKTVTTPGSS FTASGHSPSE IVPQDAPTIS AATTFAPAPT
710 720 730 740 750
GDGHTTQAPT TALQAAPSSH DATLGPSGGT SLSKTGALTL ANSVVSTPGG
760 770 780 790 800
PEGQWTSASA STSPDTAAAM THTHQAESTE ASGQTQTSEP ASSGSRTTSA
810 820 830 840 850
GTATPSSSGA SGTTPSGSEG ISTSGETTRF SSNPSRDSHT TQSTTELLSA
860 870 880 890 900
SASHGAIPVS TGMASSIVPG TFHPTLSEAS TAGRPTGQSS PTSPSASPQE
910 920 930 940 950
TAAISRMAQT QRTRTSRGSD TISLASQATD TFSTVPPTPP SITSTGLTSP
960 970 980 990 1000
QTETHTLSPS GSGKTFTTAL ISNATPLPVT YASSASTGHT TPLHVTDASS
1010 1020 1030 1040 1050
VSTGHATPLP VTSPSSVSTG HTTPLPVTDT SSESTGHVTP LPVTSFSSAS
1060 1070 1080 1090 1100
TGDSTPLPVT DTSSASTGHV TPLPVTSLSS ASTGDTTPLP VTDTSSASTG
1110 1120 1130 1140 1150
HATSLPVTDT SSVSTGHTTP LPVTDTSSAS TGHATSLPVT DTSSVSTGHT
1160 1170 1180 1190 1200
TPLHVTDASS ASTGQATPLP VTSLSSVSTG DTTPLPVTSP SSASTGHATP
1210 1220 1230 1240 1250
LLVTDTSSAS TGHATPLPVT DASSVSTDHA TSLPVTIPSA ASTGHTTPLP
1260 1270 1280 1290 1300
VTDTSSASTG QATSLLVTDT SSVSTGDTTP LPVTSTSSAS TGHVTPLHVT
1310 1320 1330 1340 1350
SPSSASTGHA TPLPVTSLSS ASTGDTMPLP VTSPSSASTG DTTPLPVTDA
1360 1370 1380 1390 1400
SSVSTGHTTP LHVTDASSAS TGQATPLPVT SLSSVSTGDT TPLPVTSPSS
1410 1420 1430 1440 1450
ASTGHATPLL VTDTSSASTG HATPLPVTDA SSVSTDHATS LPVTIPSAAS
1460 1470 1480 1490 1500
TGHTTPLPVT DTSSASTGQA TSLLVTDTSS VSTGDTTPLP VTSTSSASTG
1510 1520 1530 1540 1550
HVTPLHVTSP SSASTGHATP LPVTSLSSAS TGDTMPLPVT SPSSASTGDT
1560 1570 1580 1590 1600
TPLPVTDASS VSTGHTTPLP VTSPSSASTG HTTPLPVTDT SSASKGDTTP
1610 1620 1630 1640 1650
LPVTSPSSAS TGHTTPLPVT DTSSASTGDT TPLPVTNASS LSTGHATPLH
1660 1670 1680 1690 1700
VTSPSSASTG HATPLPVTST SSASTGHATP LPVTGLSSAT TDDTTRLPVT
1710 1720 1730 1740 1750
DVSSASTGQA TPLPVTSLSS VSTGDTTPLP VTSPSSASTG HASPLLVTDA
1760 1770 1780 1790 1800
SSASTGQATP LPVTDTSSVS TAHATPLPVT GLSSASTDDT TRLPVTDVSS
1810 1820 1830 1840 1850
ASTGQAIPLP VTSPSSASTG DTTPLPVTDA SSASTGDTTS LPVTIPSSAS
1860 1870 1880 1890 1900
SGHTTSLPVT DASSVSTGHA TSLLVTDASS VSTGDTTPLP VTDTNSASTG
1910 1920 1930 1940 1950
DTTPLHVTDA SSVSTGHATS LPVTSLSSAS TGDTTPLPVT SPSSASSGHT
1960 1970 1980 1990 2000
TPLPVTDASS VPTGHATSLP VTDASSVSTG HATPLPVTDA SSVSTGHATP
2010 2020 2030 2040 2050
LPVTDTSSVS TGQATPLPVT SLSSASTGDT TPLPVTDTSS ASTGQDTPLP
2060 2070 2080 2090 2100
VTSLSSVSTG DTTPLPVTNP SSASTGHATP LLVTDASSIS TGHATSLLVT
2110 2120 2130 2140 2150
DASSVSTGHA TALHDTDASS LSTGDTTPLP VTSPSSTSTG DTTPLPVTET
2160 2170 2180 2190 2200
SSVSTGHATS LPVTDTSSAS TGHATSLPVT DTSSASTGHA TPLPVTDTSS
2210 2220 2230 2240 2250
ASTGQATPLP VTSPSSASTG HAIPLLVTDT SSASTGQATP LPVTSLSSAS
2260 2270 2280 2290 2300
TGDTTPLPVT DASSVSTGHA TSLPVTSLSS VSTGDTTPLP VTSPSSASTG
2310 2320 2330 2340 2350
HATPLHVTDA SSASTGHATP LPVTSLSSAS TGDTTPLPVT SPSSASTGHA
2360 2370 2380 2390 2400
TPLHVTDASS VSTGDTTPLP VTSSSSASSG HTTPLPVTDA SSASTGDTTP
2410 2420 2430 2440 2450
LPVTDTSSAS TGHATHLPVT GLSSASTGDT TRLPVTNVSS ASTGHATPLP
2460 2470 2480 2490 2500
VTSTSSASTG DTTPLPGTDT SSVSTGHTTP LLVTDASSVS TGDTTRLPVT
2510 2520 2530 2540 2550
SPSSASTGHT TPLPVTDTPS ASTGDTTPLP VTNASSLSTR HATSLHVTSP
2560 2570 2580 2590 2600
SSASTGHATS LPVTDTSAAS TGHATPLPVT STSSASTGDT TPLPVTDTYS
2610 2620 2630 2640 2650
ASTGQATPLP VTSLSSVSTG DTTPLPVTSP SSASTGHATP LLVTDASSAS
2660 2670 2680 2690 2700
TGQATPLPVT SLSSVSTGDT TPLPVTSPSS ASTGHATSLP VTDTSSASTG
2710 2720 2730 2740 2750
DTTSLPVTDT SSAYTGDTTS LPVTDTSSSS TGDTTPLLVT ETSSVSTGDT
2760 2770 2780 2790 2800
TPLPVTDTSS ASTGHATPLP VTNTSSVSTG HATPLHVTSP SSASTGHTTP
2810 2820 2830 2840 2850
LPVTDASSVS TGHATSLPVT DASSVFTGHA TSLPVTIPSS ASSGHTTPLP
2860 2870 2880 2890 2900
VTDASSVSTG HATSLPVTDA SSVSTGHATP LPVTDASSVS TGHATPLPLT
2910 2920 2930 2940 2950
SLSSVSTGDT TPLPVTDTSS ASTGQATPLP VTSLSSVSTG DTTPLPVTDT
2960 2970 2980 2990 3000
SSASTGHATS LPVTDTSSAS TGHATPLPDT DTSSASTGHA TLLPVTDTSS
3010 3020 3030 3040 3050
ASIGHATSLP VTDTSSISTG HATPLHVTSP SSASTGHATP LPVTDTSSAS
3060 3070 3080 3090 3100
TGHANPLHVT SPSSASTGHA TPLPVTDTSS ASTGHATPLP VTSLSSVSTG
3110 3120 3130 3140 3150
DTTPLPVTSP SSASTGHTTP LPVTDTSSAS TGQATALPVT STSSASTGDT
3160 3170 3180 3190 3200
TPLPVTDTSS ASTGQATPLP VTSLSSVSTG DTTPLPVTSP SSASTGHATP
3210 3220 3230 3240 3250
LLVTDASSAS TGQATPLPVT SLSSVSTGDT TPLPVTSPSS ASTGHATSLP
3260 3270 3280 3290 3300
VTDTSSASTG DTTSLPVTDT SSAYTGDTTS LPVTDTSSSS TGDTTPLLVT
3310 3320 3330 3340 3350
ETSSVSTGHA TPLLVTDASS ASTGHATPLH VTSPSSASTG DTTPVPVTDT
3360 3370 3380 3390 3400
SSVSTGHATP LPVTGLSSAS TGDTTRLPVT DISSASTGQA TPLPVTNTSS
3410 3420 3430 3440 3450
VSTGDTMPLP VTSPSSASTG HATPLPVTST SSASTGHATP VPVTSTSSAS
3460 3470 3480 3490 3500
TGHTTPLPVT DTSSASTGDT TPLPVTSPSS ASTGHTTPLH VTIPSSASTG
3510 3520 3530 3540 3550
DTSTLPVTGA SSASTGHATP LPVTDTSSVS TGHATPLPVT SLSSVSTGDT
3560 3570 3580 3590 3600
TPLPVTDASS ASTGQATPLP VTSLSSVSTG DTTPLLVTDA SSVSTGHATP
3610 3620 3630 3640 3650
LPVTDTSSAS TGDTTRLPVT DTSSASTGQA TPLPVTSLSS VSTGDTTPLL
3660 3670 3680 3690 3700
VTDASSVSTG HATPLPVTDT SSASTGDTTR LPVTDTSSAS TGQATPLPVT
3710 3720 3730 3740 3750
IPSSSSSGHT TPLPVTSTSS VSTGHVTPLH VTSPSSASTG HVTPLPVTST
3760 3770 3780 3790 3800
SSASTGHATP LLVTDASSVS TGHATPLPVT DASSASTGDT TPLPVTDTSS
3810 3820 3830 3840 3850
ASTGQATPLP VTSLSSVSTG DTTPLPVTDA SSASTGHATP LPVTIPSSVS
3860 3870 3880 3890 3900
TGDTMPLPVT SPSSASTGHA TPLPVTGLSS ASTGDTTPLP VTDTSSASTR
3910 3920 3930 3940 3950
HATPLPVTDT SSASTDDTTR LPVTDVSSAS TGHATPLPVT STSSASTGDT
3960 3970 3980 3990 4000
TPLPVTDTSS VSTGHATSLP VTSRSSASTG HATPLPVTDT SSVSTGHATP
4010 4020 4030 4040 4050
LPVTSTSSVS TGHATPLPVT SPSSASTGHA TPVPVTSTSS ASTGDTTPLP
4060 4070 4080 4090 4100
VTNASSLSTG HATPLHVTSP SSASRGDTST LPVTDASSAS TGHATPLPLT
4110 4120 4130 4140 4150
SLSSVSTGDT TPLPVTDTSS ASTGQATPLP VTSLSSVSTG DTTPLPVTIP
4160 4170 4180 4190 4200
SSASSGHTTS LPVTDASSVS TGHGTPLPVT STSSASTGDT TPLPVTDTSS
4210 4220 4230 4240 4250
ASTGHATPLP VTDTSSASTG HATPLPVTSL SSVSTGHATP LAVSSATSAS
4260 4270 4280 4290 4300
TVSSDSPLKM ETPGMTTPSL KTDGGRRTAT SPPPTTSQTI ISTIPSTAMH
4310 4320 4330 4340 4350
TRSTAAPIPI LPERGVSLFP YGAGAGDLEF VRRTVDFTSP LFKPATGFPL
4360 4370 4380 4390 4400
GSSLRDSLYF TDNGQIIFPE SDYQIFSYPN PLPTGFTGRD PVALVAPFWD
4410 4420 4430 4440 4450
DADFSTGRGT TFYQEYETFY GEHSLLVQQA ESWIRKMTNN GGYKARWALK
4460 4470 4480 4490 4500
VTWVNAHAYP AQWTLGSNTY QAILSTDGSR SYALFLYQSG GMQWDVAQRS
4510 4520 4530 4540 4550
GNPVLMGFSS GDGYFENSPL MSQPVWERYR PDRFLNSNSG LQGLQFYRLH
4560 4570 4580 4590 4600
REERPNYRLE CLQWLKSQPR WPSWGWNQVS CPCSWQQGRR DLRFQPVSIG
4610 4620 4630 4640 4650
RWGLGSRQLC SFTSWRGGVC CSYGPWGEFR EGWHVQRPWQ LAQELEPQSW
4660 4670 4680 4690 4700
CCRWNDKPYL CALYQQRRPH VGCATYRPPQ PAWMFGDPHI TTLDGVSYTF
4710 4720 4730 4740 4750
NGLGDFLLVG AQDGNSSFLL QGRTAQTGSA QATNFIAFAA QYRSSSLGPV
4760 4770 4780 4790 4800
TVQWLLEPHD AIRVLLDNQT VTFQPDHEDG GGQETFNATG VLLSRNGSEV
4810 4820 4830 4840 4850
SASFDGWATV SVIALSNILH ASASLPPEYQ NRTEGLLGVW NNNPEDDFRM
4860 4870 4880 4890 4900
PNGSTIPPGS PEEMLFHFGM TWQINGTGLL GKRNDQLPSN FTPVFYSQLQ
4910 4920 4930 4940 4950
KNSSWAEHLI SNCDGDSSCI YDTLALRNAS IGLHTREVSK NYEQANATLN
4960 4970 4980 4990 5000
QYPPSINGGR VIEAYKGQTT LIQYTSNAED ANFTLRDSCT DLELFENGTL
5010 5020 5030 5040 5050
LWTPKSLEPF TLEILARSAK IGLASALQPR TVVCHCNAES QCLYNQTSRV
5060 5070 5080 5090 5100
GNSSLEVAGC KCDGGTFGRY CEGSEDACEE PCFPSVHCVP GKGCEACPPN
5110 5120 5130 5140 5150
LTGDGRHCAA LGSSFLCQNQ SCPVNYCYNQ GHCYISQTLG CQPMCTCPPA
5160 5170 5180 5190 5200
FTDSRCFLAG NNFSPTVNLE LPLRVIQLLL SEEENASMAE VNASVAYRLG
5210 5220 5230 5240 5250
TLDMRAFLRN SQVERIDSAA PASGSPIQHW MVISEFQYRP RGPVIDFLNN
5260 5270 5280 5290 5300
QLLAAVVEAF LYHVPRRSEE PRNDVVFQPI SGEDVRDVTA LNVSTLKAYF
5310 5320 5330 5340 5350
RCDGYKGYDL VYSPQSGFTC VSPCSRGYCD HGGQCQHLPS GPRCSCVSFS
5360 5370 5380 5390 5400
IYTAWGEHCE HLSMKLDAFF GIFFGALGGL LLLGVGTFVV LRFWGCSGAR
5410
FSYFLNSAEA LP
Length:5,412
Mass (Da):542,307
Last modified:September 29, 2021 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCA70610C2C0FC5B0
GO
Isoform 2 (identifier: Q99102-2) [UniParc]FASTAAdd to basket
Also known as: Sv3-MUC41 Publication, Sv4-MUC41 Publication, Sv5-MUC41 Publication, Sv121 Publication, Sv131 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4360-4400: FTDNGQIIFP...PVALVAPFWD → ASQAGTLWPW...TRRSMVNTAC
     4401-5412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:4,400
Mass (Da):429,631
Checksum:iC098A5EF9FE1DD53
GO
Isoform 3 (identifier: Q99102-3) [UniParc]FASTAAdd to basket
Also known as: Sv201 Publication, sv7-MUC41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     5057-5070: VAGCKCDGGTFGRY → LWGALSCVRTSPAL
     5071-5412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:5,070
Mass (Da):504,936
Checksum:i1816B75C569A23E9
GO
Isoform 5 (identifier: Q99102-5) [UniParc]FASTAAdd to basket
Also known as: Sv181 Publication, Sv191 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4415-4466: Missing.
     4501-4510: GNPVLMGFSS → VEMAFSKTAH
     4511-5412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:4,458
Mass (Da):436,140
Checksum:i01DE28FAB5B89FD9
GO
Isoform 7 (identifier: Q99102-7) [UniParc]FASTAAdd to basket
Also known as: Sv161 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4360-4444: FTDNGQIIFP...RKMTNNGGYK → ASQAGTLWPW...VPASVGEVSP
     4445-5412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:4,444
Mass (Da):434,209
Checksum:iF878142311B87C0A
GO
Isoform 8 (identifier: Q99102-8) [UniParc]FASTAAdd to basket
Also known as: Sv151 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4360-4442: FTDNGQIIFP...WIRKMTNNGG → ASQAGTLWPW...VEMAFSKTAH
     4443-5412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:4,442
Mass (Da):433,835
Checksum:i6C252B0B2EA8A342
GO
Isoform 9 (identifier: Q99102-9) [UniParc]FASTAAdd to basket
Also known as: Sv111 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4314-4350: RGVSLFPYGAGAGDLEFVRRTVDFTSPLFKPATGFPL → SPLWGRRRGPGVRQEDRGLHLPTLQAGDWLPPWLLSP
     4351-5412: Missing.

Note: Dubious isoform produced through aberrant splice sites.Curated
Show »
Length:4,350
Mass (Da):424,339
Checksum:i26FF103863E46796
GO
Isoform 10 (identifier: Q99102-10) [UniParc]FASTAAdd to basket
Also known as: Sv3, Sv171 Publication, Sv101 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4415-4466: Missing.

Show »
Length:5,360
Mass (Da):536,223
Checksum:iD6B8374B2DCE10C9
GO
Isoform 11 (identifier: Q99102-11) [UniParc]FASTAAdd to basket
Also known as: Sv21 Publication, Sv91 Publication, Sv141 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4316-4430: VSLFPYGAGA...GEHSLLVQQA → EAIQEFPSSP...TRRSMVNTAC
     4431-5412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:4,430
Mass (Da):432,689
Checksum:i1C56EFF8C1071E80
GO
Isoform 12 (identifier: Q99102-12) [UniParc]FASTAAdd to basket
Also known as: SvX, MUC4/X1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     29-4315: Missing.

Note: May be preferentially expressed in tumor tissues.1 Publication
Show »
Length:1,125
Mass (Da):125,130
Checksum:iD1750D4908B75B6D
GO
Isoform 13 (identifier: Q99102-13) [UniParc]FASTAAdd to basket
Also known as: SvY, MUC4/Y1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     29-4264: Missing.

Note: May be preferentially expressed in tumor tissues.1 Publication
Show »
Length:1,176
Mass (Da):130,415
Checksum:i92B845E20A242187
GO
Isoform 15 (identifier: Q99102-15) [UniParc]FASTAAdd to basket
Also known as: Sv11 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4316-4420: VSLFPYGAGA...TFYQEYETFY → AIQEFPSSPM...LVGGPHFIRL
     4421-5412: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:4,419
Mass (Da):431,438
Checksum:i205246CF420246D6
GO
Isoform 16 (identifier: Q99102-16) [UniParc]FASTAAdd to basket
Also known as: Sv6-MUC41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4579-4627: VSCPCSWQQG...GVCCSYGPWG → AAPPRLAQPR...QSVSCWITRL
     4628-5412: Missing.

Note: Dubious isoform produced through aberrant splice sites.Curated
Show »
Length:4,627
Mass (Da):455,635
Checksum:i3875727ECCCE3235
GO
Isoform 17 (identifier: Q99102-17) [UniParc]FASTAAdd to basket
Also known as: Sv8-MUC41 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     4597-4822: Missing.

Note: Dubious isoform produced through aberrant splice sites.Curated
Show »
Length:5,186
Mass (Da):517,394
Checksum:i14D02731703982EB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 55 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PDY6E9PDY6_HUMAN
Mucin-4
MUC4
5,412Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ENC5E7ENC5_HUMAN
Mucin-4
MUC4
5,360Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JS65A0A0G2JS65_HUMAN
Mucin-4
MUC4
7,418Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JR97A0A0G2JR97_HUMAN
Mucin-4
MUC4
7,366Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JSC3A0A0G2JSC3_HUMAN
Mucin-4
MUC4
1,176Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JM16A0A0G2JM16_HUMAN
Mucin-4
MUC4
5,314Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JNL3A0A0G2JNL3_HUMAN
Mucin-4
MUC4
2,138Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JQT8A0A0G2JQT8_HUMAN
Mucin-4
MUC4
5,334Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JRA1A0A0G2JRA1_HUMAN
Mucin-4
MUC4
5,386Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JMX1A0A0G2JMX1_HUMAN
Mucin-4
MUC4
5,333Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAA63230 differs from that shown. May be derived from an intron translation.Curated
The sequence CAC14139 differs from that shown. Reason: Frameshift.Curated
The sequence CAC14141 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti111M → METVTQ in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti300F → V in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti377T → I in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti398T → I in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti524 – 525GT → RA in CAB81773 (PubMed:10920259).Curated2
Sequence conflicti587T → I in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti641Q → R in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti702D → N in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti914R → G in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti945T → S in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti953E → Q in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti4263P → S in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti4437M → I in CAB85602 (PubMed:10880978).Curated1
Sequence conflicti4437M → I in CAB85603 (PubMed:10880978).Curated1
Sequence conflicti4437M → I in CAB85604 (PubMed:10880978).Curated1
Sequence conflicti4437M → I in CAB85605 (PubMed:10880978).Curated1
Sequence conflicti4437M → I in CAB85606 (PubMed:10880978).Curated1
Sequence conflicti4437M → I in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti4437M → I in CAC14141 (PubMed:10920259).Curated1
Sequence conflicti4437M → I in CAC14142 (PubMed:10920259).Curated1
Sequence conflicti4437M → I in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti4437M → I in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti4437M → I in CAD22550 (PubMed:10024507).Curated1
Sequence conflicti4437M → I in CAB38059 (PubMed:12153560).Curated1
Sequence conflicti4502N → K in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti4502N → K in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti4502N → K in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti4502N → K in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti4514Y → F in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti4514Y → F in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti4514Y → F in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti4514Y → F in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti4548R → G in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti4548R → G in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti4548R → G in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti4548R → G in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti4800V → A in CAB81773 (PubMed:10920259).Curated1
Sequence conflicti4800V → A in CAC14143 (PubMed:10920259).Curated1
Sequence conflicti4800V → A in CAC10061 (PubMed:10920259).Curated1
Sequence conflicti4800V → A in AAM66747 (PubMed:12084055).Curated1
Sequence conflicti5163 – 5164Missing in CAC14143 (PubMed:10920259).Curated2
Sequence conflicti5282G → E in CAB85604 (PubMed:10880978).Curated1
Sequence conflicti5282G → E in CAB85605 (PubMed:10880978).Curated1
Sequence conflicti5282G → E in CAB85606 (PubMed:10880978).Curated1
Sequence conflicti5282G → E in CAD22550 (PubMed:10024507).Curated1
Sequence conflicti5282G → E in CAB38059 (PubMed:12153560).Curated1

<p>This subsection of the 'Sequence' section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement%5Fin%5Fdisease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

The variable number of tandem repeats (VNTR) region, an array of serine- and threonine-rich tandem repeats, is encoded by a single exon (exon 2) which is highly polymorphic.1 Publication

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03021137G → D. Corresponds to variant dbSNP:rs2259292Ensembl.1
Natural variantiVAR_06526141A → P2 PublicationsCorresponds to variant dbSNP:rs3107764Ensembl.1
Natural variantiVAR_030212156T → A. Corresponds to variant dbSNP:rs2293232Ensembl.1
Natural variantiVAR_030213580S → A. Corresponds to variant dbSNP:rs2246901Ensembl.1
Natural variantiVAR_056585716A → T. Corresponds to variant dbSNP:rs3749331Ensembl.1
Natural variantiVAR_0652624324G → D5 PublicationsCorresponds to variant dbSNP:rs2259292Ensembl.1
Natural variantiVAR_0565864448A → T. Corresponds to variant dbSNP:rs2293232Ensembl.1
Natural variantiVAR_0565874821A → S1 PublicationCorresponds to variant dbSNP:rs2246901Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02265029 – 4315Missing in isoform 12. 1 PublicationAdd BLAST4287
Alternative sequenceiVSP_02265129 – 4264Missing in isoform 13. 1 PublicationAdd BLAST4236
Alternative sequenceiVSP_0226524314 – 4350RGVSL…TGFPL → SPLWGRRRGPGVRQEDRGLH LPTLQAGDWLPPWLLSP in isoform 9. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_0226534316 – 4430VSLFP…LVQQA → EAIQEFPSSPMGQTPGTWSS SGGPWTSPPHSSSRRLASPL APLSVIPSTSQTMARSSSQS QTTRFSPTPTHSQQASQAGT LWPWWLRSGTMLTSPLVGGP HFIRNTRRSMVNTAC in isoform 11. 1 PublicationAdd BLAST115
Alternative sequenceiVSP_0226544316 – 4420VSLFP…YETFY → AIQEFPSSPMGQTPGTWSSS GGPWTSPPHSSSRRLASPLA PLSVIPSTSQTMARSSSQSQ TTRFSPTPTHSQQASQAGTL WPWWLRSGTMLTSPLVGGPH FIRL in isoform 15. CuratedAdd BLAST105
Alternative sequenceiVSP_0226554351 – 5412Missing in isoform 9. 1 PublicationAdd BLAST1062
Alternative sequenceiVSP_0226564360 – 4444FTDNG…NGGYK → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQWRWLFRKQPTDVPASV GEVSP in isoform 7. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_0226574360 – 4442FTDNG…TNNGG → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRATPTKPSSPR TGAGPMPCFSTRAVGCSGTW PSAQASRCSWASLVEMAFSK TAH in isoform 8. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_0226584360 – 4400FTDNG…APFWD → ASQAGTLWPWWLRSGTMLTS PLVGGPHFIRNTRRSMVNTA C in isoform 2. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_0226594401 – 5412Missing in isoform 2. 1 PublicationAdd BLAST1012
Alternative sequenceiVSP_0226614415 – 4466Missing in isoform 5 and isoform 10. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_0226624421 – 5412Missing in isoform 15. CuratedAdd BLAST992
Alternative sequenceiVSP_0226634431 – 5412Missing in isoform 11. 1 PublicationAdd BLAST982
Alternative sequenceiVSP_0226644443 – 5412Missing in isoform 8. 1 PublicationAdd BLAST970
Alternative sequenceiVSP_0226654445 – 5412Missing in isoform 7. 1 PublicationAdd BLAST968
Alternative sequenceiVSP_0226694501 – 4510GNPVLMGFSS → VEMAFSKTAH in isoform 5. 1 Publication10
Alternative sequenceiVSP_0226704511 – 5412Missing in isoform 5. 1 PublicationAdd BLAST902
Alternative sequenceiVSP_0226714579 – 4627VSCPC…YGPWG → AAPPRLAQPRPPTSSPLRLS TAPAAWAPSRSNGSLSLTTQ SVSCWITRL in isoform 16. CuratedAdd BLAST49
Alternative sequenceiVSP_0226724597 – 4822Missing in isoform 17. CuratedAdd BLAST226
Alternative sequenceiVSP_0226734628 – 5412Missing in isoform 16. CuratedAdd BLAST785
Alternative sequenceiVSP_0226745057 – 5070VAGCK…TFGRY → LWGALSCVRTSPAL in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_0226755071 – 5412Missing in isoform 3. 1 PublicationAdd BLAST342

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ242541 mRNA Translation: CAB85597.1
AJ242542 mRNA Translation: CAB85598.1
AJ242543 mRNA Translation: CAB85599.1
AJ242544 mRNA Translation: CAB85600.1
AJ242545 mRNA Translation: CAB85601.1
AJ242546 mRNA Translation: CAB85602.1
AJ242547 mRNA Translation: CAB85603.1
AJ242548 mRNA Translation: CAB85604.1
AJ242549 mRNA Translation: CAB85605.1
AJ242550 mRNA Translation: CAB85606.1
AJ276359 mRNA Translation: CAB81773.1
AJ277412 mRNA Translation: CAC10061.1
AJ277505 mRNA Translation: CAC14585.1
AJ400633 mRNA Translation: CAC10062.1
AJ400849 mRNA Translation: CAC14134.1
AJ400850 mRNA Translation: CAC14135.1
AJ400851 mRNA Translation: CAC14136.1
AJ400852 mRNA Translation: CAC14137.1
AJ400855 mRNA Translation: CAC14140.1
AJ400853 mRNA Translation: CAC14138.1
AJ400854 mRNA Translation: CAC14139.1 Frameshift.
AJ400856 mRNA Translation: CAC14141.1 Frameshift.
AJ400857 mRNA Translation: CAC14142.1
AJ400858 mRNA Translation: CAC14143.1
AF522055 AF522054 Genomic DNA Translation: AAM66747.1
AJ010901 mRNA Translation: CAB38059.1
AJ430032, AJ430033, AJ430034 Genomic DNA Translation: CAD22550.1
M64594 mRNA Translation: AAA63230.1 Sequence problems.
AC069513 Genomic DNA No translation available.
AC233280 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3310.1 [Q99102-13]
CCDS3311.1 [Q99102-12]
CCDS54700.1 [Q99102-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
PN0012

NCBI Reference Sequences

More...
RefSeqi
NP_004523.3, NM_004532.5 [Q99102-13]
NP_060876.5, NM_018406.6 [Q99102-1]
NP_612154.2, NM_138297.4 [Q99102-12]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000346145.8; ENSP00000304207.6; ENSG00000145113.22 [Q99102-13]
ENST00000349607.8; ENSP00000338109.4; ENSG00000145113.22 [Q99102-12]
ENST00000463781.8; ENSP00000417498.3; ENSG00000145113.22
ENST00000470451.5; ENSP00000420439.1; ENSG00000145113.22 [Q99102-7]
ENST00000475231.5; ENSP00000420243.1; ENSG00000145113.22 [Q99102-10]
ENST00000477086.5; ENSP00000419989.1; ENSG00000145113.22 [Q99102-2]
ENST00000478156.5; ENSP00000419798.1; ENSG00000145113.22 [Q99102-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4585

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4585

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...
MANE-Selecti
ENST00000463781.8; ENSP00000417498.3; NM_018406.7; NP_060876.5

UCSC genome browser

More...
UCSCi
uc003fvo.5, human [Q99102-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi