Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Granulocyte colony-stimulating factor receptor

Gene

CSF3R

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Receptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.1 Publication

Miscellaneous

Mutations in CSF3R acquired in multipotent hematopoietic progenitor cells and resulting in truncated hyper-responsive forms of the receptor, have been identified in most cases of severe congenital neutropenia (SCN). Patients carrying these mutations are at risk for developing myelodysplastic syndromes and/or acute myeloid leukemia. Constitutive mutations leading to hyporesponsive forms of the receptor are responsible for the refractoriness to CSF3 treatment observed in some SCN patients.

GO - Molecular functioni

  • cytokine binding Source: GO_Central
  • cytokine receptor activity Source: GO_Central
  • granulocyte colony-stimulating factor binding Source: Ensembl
  • interleukin-3 binding Source: GO_Central
  • interleukin-3 receptor activity Source: GO_Central
  • signaling receptor activity Source: ProtInc

GO - Biological processi

Keywordsi

Molecular functionReceptor
Biological processCell adhesion

Enzyme and pathway databases

ReactomeiR-HSA-449836 Other interleukin signaling
SignaLinkiQ99062
SIGNORiQ99062

Names & Taxonomyi

Protein namesi
Recommended name:
Granulocyte colony-stimulating factor receptor
Short name:
G-CSF receptor
Short name:
G-CSF-R
Alternative name(s):
CD_antigen: CD114
Gene namesi
Name:CSF3R
Synonyms:GCSFR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000119535.17
HGNCiHGNC:2439 CSF3R
MIMi138971 gene
neXtProtiNX_Q99062

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini25 – 627ExtracellularSequence analysisAdd BLAST603
Transmembranei628 – 650HelicalSequence analysisAdd BLAST23
Topological domaini651 – 836CytoplasmicSequence analysisAdd BLAST186

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Involvement in diseasei

Hereditary neutrophilia (NEUTROPHILIA)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of lifelong, persistent neutrophilia, a condition characterized by an increase in the number of neutrophils in the blood.
See also OMIM:162830
Neutropenia, severe congenital 7, autosomal recessive (SCN7)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of severe congenital neutropenia, a disorder of hematopoiesis characterized by maturation arrest of granulopoiesis at the level of promyelocytes with peripheral blood absolute neutrophil counts below 0.5 x 10(9)/l and early onset of severe bacterial infections.
See also OMIM:617014
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_077011308R → C in SCN7; decreases localization to plasma membrane; decreases receptor signaling. 1 PublicationCorresponds to variant dbSNP:rs606231473EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi1441
MalaCardsiCSF3R
MIMi162830 phenotype
617014 phenotype
OpenTargetsiENSG00000119535
Orphaneti98824 Atypical chronic myeloid leukemia
420702 Autosomal recessive severe congenital neutropenia due to CSF3R deficiency
86829 Chronic neutrophilic leukemia
279943 Hereditary neutrophilia
PharmGKBiPA26942

Chemistry databases

ChEMBLiCHEMBL1996
DrugBankiDB05249 FavId
DB00099 Filgrastim
DB09560 Filgrastim-sndz
DB13144 Lenograstim
DB00019 Pegfilgrastim

Polymorphism and mutation databases

BioMutaiCSF3R
DMDMi729564

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Add BLAST24
ChainiPRO_000001087425 – 836Granulocyte colony-stimulating factor receptorAdd BLAST812

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi26 ↔ 521 Publication
Disulfide bondi46 ↔ 1011 Publication
Glycosylationi51N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi93N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi128N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi131 ↔ 1421 Publication
Glycosylationi134N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi167 ↔ 2181 Publication
Disulfide bondi177 ↔ 1861 Publication
Disulfide bondi248 ↔ 2951 Publication
Disulfide bondi266 ↔ 3091 Publication
Glycosylationi389N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi474N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi579N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi610N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ99062
PeptideAtlasiQ99062
PRIDEiQ99062
ProteomicsDBi78226
78227 [Q99062-2]
78228 [Q99062-3]
78229 [Q99062-4]

PTM databases

iPTMnetiQ99062
PhosphoSitePlusiQ99062

Expressioni

Tissue specificityi

One or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U-937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U-937 cells. Isoform GCSFR-3 is highly expressed in placenta.

Gene expression databases

BgeeiENSG00000119535 Expressed in 145 organ(s), highest expression level in blood
CleanExiHS_CSF3R
ExpressionAtlasiQ99062 baseline and differential
GenevisibleiQ99062 HS

Organism-specific databases

HPAiCAB017116
HPA048086

Interactioni

Subunit structurei

Homodimer. The dimeric receptor binds two CSF3 molecules. Interacts with CEACAM1; down-regulates the CSF3R-STAT3 pathway through recruitment of PTPN6 that dephosphorylates CSF3R (By similarity).By similarity1 Publication

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107828, 13 interactors
CORUMiQ99062
DIPiDIP-5788N
ELMiQ99062
IntActiQ99062, 3 interactors
MINTiQ99062
STRINGi9606.ENSP00000362195

Chemistry databases

BindingDBiQ99062

Structurei

Secondary structure

1836
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ99062
SMRiQ99062
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ99062

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 117Ig-like C2-typeAdd BLAST93
Domaini125 – 230Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST106
Domaini233 – 332Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST100
Domaini334 – 430Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST97
Domaini431 – 528Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98
Domaini530 – 623Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST94

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi318 – 322WSXWS motif5
Motifi658 – 666Box 1 motif9

Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.1 Publication
The box 1 motif is required for JAK interaction and/or activation.1 Publication

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGHT Eukaryota
ENOG410XVIU LUCA
GeneTreeiENSGT00550000074436
HOGENOMiHOG000231142
HOVERGENiHBG051130
InParanoidiQ99062
KOiK05061
OMAiVQAYVLQ
OrthoDBiEOG091G01XM
PhylomeDBiQ99062
TreeFamiTF338122

Family and domain databases

CDDicd00063 FN3, 4 hits
Gene3Di2.60.40.10, 6 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR003529 Hematopoietin_rcpt_Gp130_CS
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR010457 IgC2-like_lig-bd
PfamiView protein in Pfam
PF00041 fn3, 1 hit
PF06328 Lep_receptor_Ig, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 5 hits
SUPFAMiSSF48726 SSF48726, 1 hit
SSF49265 SSF49265, 4 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 5 hits
PS01353 HEMATOPO_REC_L_F2, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist. Experimental confirmation may be lacking for some isoforms.

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q99062-1) [UniParc]FASTAAdd to basket
Also known as: GCSFR-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARLGNCSLT WAALIILLLP GSLEECGHIS VSAPIVHLGD PITASCIIKQ
60 70 80 90 100
NCSHLDPEPQ ILWRLGAELQ PGGRQQRLSD GTQESIITLP HLNHTQAFLS
110 120 130 140 150
CCLNWGNSLQ ILDQVELRAG YPPAIPHNLS CLMNLTTSSL ICQWEPGPET
160 170 180 190 200
HLPTSFTLKS FKSRGNCQTQ GDSILDCVPK DGQSHCCIPR KHLLLYQNMG
210 220 230 240 250
IWVQAENALG TSMSPQLCLD PMDVVKLEPP MLRTMDPSPE AAPPQAGCLQ
260 270 280 290 300
LCWEPWQPGL HINQKCELRH KPQRGEASWA LVGPLPLEAL QYELCGLLPA
310 320 330 340 350
TAYTLQIRCI RWPLPGHWSD WSPSLELRTT ERAPTVRLDT WWRQRQLDPR
360 370 380 390 400
TVQLFWKPVP LEEDSGRIQG YVVSWRPSGQ AGAILPLCNT TELSCTFHLP
410 420 430 440 450
SEAQEVALVA YNSAGTSRPT PVVFSESRGP ALTRLHAMAR DPHSLWVGWE
460 470 480 490 500
PPNPWPQGYV IEWGLGPPSA SNSNKTWRME QNGRATGFLL KENIRPFQLY
510 520 530 540 550
EIIVTPLYQD TMGPSQHVYA YSQEMAPSHA PELHLKHIGK TWAQLEWVPE
560 570 580 590 600
PPELGKSPLT HYTIFWTNAQ NQSFSAILNA SSRGFVLHGL EPASLYHIHL
610 620 630 640 650
MAASQAGATN STVLTLMTLT PEGSELHIIL GLFGLLLLLT CLCGTAWLCC
660 670 680 690 700
SPNRKNPLWP SVPDPAHSSL GSWVPTIMEE DAFQLPGLGT PPITKLTVLE
710 720 730 740 750
EDEKKPVPWE SHNSSETCGL PTLVQTYVLQ GDPRAVSTQP QSQSGTSDQV
760 770 780 790 800
LYGQLLGSPT SPGPGHYLRC DSTQPLLAGL TPSPKSYENL WFQASPLGTL
810 820 830
VTPAPSQEDD CVFGPLLNFP LLQGIRVHGM EALGSF
Length:836
Mass (Da):92,156
Last modified:February 1, 1995 - v1
Checksum:i3531ADDC979D4BC3
GO
Isoform 2 (identifier: Q99062-2) [UniParc]FASTAAdd to basket
Also known as: GCSFR-2

The sequence of this isoform differs from the canonical sequence as follows:
     622-836: EGSELHIILG...VHGMEALGSF → APTGRIPSGQ...GSRPAPWGPW

Show »
Length:771
Mass (Da):85,120
Checksum:i2483E94E3A57322A
GO
Isoform 3 (identifier: Q99062-3) [UniParc]FASTAAdd to basket
Also known as: GCSFR-3

The sequence of this isoform differs from the canonical sequence as follows:
     680-680: E → ELPGPRQGQWLGQTSEMSRALTPHPCVQ

Show »
Length:863
Mass (Da):95,114
Checksum:i6951B4F2C9FED675
GO
Isoform 4 (identifier: Q99062-4) [UniParc]FASTAAdd to basket
Also known as: GCSFR-4, D7

The sequence of this isoform differs from the canonical sequence as follows:
     750-783: VLYGQLLGSPTSPGPGHYLRCDSTQPLLAGLTPS → AGPPRRSAYFKDQIMLHPAPPNGLLCLFPITSVL
     784-836: Missing.

Show »
Length:783
Mass (Da):86,609
Checksum:i9D85EC2298D42BF3
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YE86H0YE86_HUMAN
Granulocyte colony-stimulating fact...
CSF3R
388Annotation score:
E9PK56E9PK56_HUMAN
Granulocyte colony-stimulating fact...
CSF3R
21Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_062517229P → H Probable disease-associated mutation found in a patient with apparently autosomal dominant severe congenital neutropenia; affects CSF3 mediated proliferation and survival of myeloid cells; abrogates receptor signaling by altering ligand binding; dominant negative effect. 1 PublicationCorresponds to variant dbSNP:rs764202764Ensembl.1
Natural variantiVAR_014325231M → T1 PublicationCorresponds to variant dbSNP:rs3917973EnsemblClinVar.1
Natural variantiVAR_077011308R → C in SCN7; decreases localization to plasma membrane; decreases receptor signaling. 1 PublicationCorresponds to variant dbSNP:rs606231473EnsemblClinVar.1
Natural variantiVAR_014326320D → N1 PublicationCorresponds to variant dbSNP:rs3918018EnsemblClinVar.1
Natural variantiVAR_014327346Q → R1 PublicationCorresponds to variant dbSNP:rs3917974EnsemblClinVar.1
Natural variantiVAR_014328405E → K1 PublicationCorresponds to variant dbSNP:rs3918019EnsemblClinVar.1
Natural variantiVAR_014329440R → Q1 PublicationCorresponds to variant dbSNP:rs3918020EnsemblClinVar.1
Natural variantiVAR_014330510D → H1 PublicationCorresponds to variant dbSNP:rs3917991EnsemblClinVar.1
Natural variantiVAR_014331562Y → H1 PublicationCorresponds to variant dbSNP:rs3917996EnsemblClinVar.1
Natural variantiVAR_014332583R → C1 PublicationCorresponds to variant dbSNP:rs3917997Ensembl.1
Natural variantiVAR_063065640T → N in neutrophilia. 1 PublicationCorresponds to variant dbSNP:rs121918426EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001674622 – 836EGSEL…ALGSF → APTGRIPSGQVSQTQLTAAW APGCPQSWRRMPSSCPALAR HPSPSSQCWRRMKRSRCPGS PITAQRPVASPLWSRPMCSR GTQEQFPPSPNPSLAPAIRS FMGSCWAAPQAQGQGTISAV TPLSPSWRASPPAPSPMRTS GSRPAPWGPW in isoform 2. 1 PublicationAdd BLAST215
Alternative sequenceiVSP_001673680E → ELPGPRQGQWLGQTSEMSRA LTPHPCVQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_001671750 – 783VLYGQ…GLTPS → AGPPRRSAYFKDQIMLHPAP PNGLLCLFPITSVL in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_001672784 – 836Missing in isoform 4. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X55721 mRNA Translation: CAA39253.1
X55720 mRNA Translation: CAA39252.1
M59818 mRNA Translation: AAA63176.1
M59819 mRNA Translation: AAA63177.1
M59820 mRNA Translation: AAA63178.1
S71484 Genomic DNA Translation: AAB20660.1
AY148100 Genomic DNA Translation: AAN05790.1
BC053585 mRNA Translation: AAH53585.1
CCDSiCCDS412.1 [Q99062-4]
CCDS413.1 [Q99062-1]
CCDS414.1 [Q99062-3]
PIRiB38252
C38252
JH0329
RefSeqiNP_000751.1, NM_000760.3 [Q99062-1]
NP_724781.1, NM_156039.3 [Q99062-3]
NP_758519.1, NM_172313.2 [Q99062-4]
XP_011539050.1, XM_011540748.2 [Q99062-3]
XP_016855859.1, XM_017000370.1 [Q99062-3]
UniGeneiHs.524517

Genome annotation databases

EnsembliENST00000331941; ENSP00000332180; ENSG00000119535 [Q99062-4]
ENST00000361632; ENSP00000355406; ENSG00000119535 [Q99062-1]
ENST00000373103; ENSP00000362195; ENSG00000119535 [Q99062-3]
ENST00000373104; ENSP00000362196; ENSG00000119535 [Q99062-4]
ENST00000373106; ENSP00000362198; ENSG00000119535 [Q99062-1]
GeneIDi1441
KEGGihsa:1441
UCSCiuc001cav.3 human [Q99062-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X55721 mRNA Translation: CAA39253.1
X55720 mRNA Translation: CAA39252.1
M59818 mRNA Translation: AAA63176.1
M59819 mRNA Translation: AAA63177.1
M59820 mRNA Translation: AAA63178.1
S71484 Genomic DNA Translation: AAB20660.1
AY148100 Genomic DNA Translation: AAN05790.1
BC053585 mRNA Translation: AAH53585.1
CCDSiCCDS412.1 [Q99062-4]
CCDS413.1 [Q99062-1]
CCDS414.1 [Q99062-3]
PIRiB38252
C38252
JH0329
RefSeqiNP_000751.1, NM_000760.3 [Q99062-1]
NP_724781.1, NM_156039.3 [Q99062-3]
NP_758519.1, NM_172313.2 [Q99062-4]
XP_011539050.1, XM_011540748.2 [Q99062-3]
XP_016855859.1, XM_017000370.1 [Q99062-3]
UniGeneiHs.524517

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AZ7model-A125-331[»]
2D9QX-ray2.80B25-332[»]
ProteinModelPortaliQ99062
SMRiQ99062
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107828, 13 interactors
CORUMiQ99062
DIPiDIP-5788N
ELMiQ99062
IntActiQ99062, 3 interactors
MINTiQ99062
STRINGi9606.ENSP00000362195

Chemistry databases

BindingDBiQ99062
ChEMBLiCHEMBL1996
DrugBankiDB05249 FavId
DB00099 Filgrastim
DB09560 Filgrastim-sndz
DB13144 Lenograstim
DB00019 Pegfilgrastim

PTM databases

iPTMnetiQ99062
PhosphoSitePlusiQ99062

Polymorphism and mutation databases

BioMutaiCSF3R
DMDMi729564

Proteomic databases

PaxDbiQ99062
PeptideAtlasiQ99062
PRIDEiQ99062
ProteomicsDBi78226
78227 [Q99062-2]
78228 [Q99062-3]
78229 [Q99062-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331941; ENSP00000332180; ENSG00000119535 [Q99062-4]
ENST00000361632; ENSP00000355406; ENSG00000119535 [Q99062-1]
ENST00000373103; ENSP00000362195; ENSG00000119535 [Q99062-3]
ENST00000373104; ENSP00000362196; ENSG00000119535 [Q99062-4]
ENST00000373106; ENSP00000362198; ENSG00000119535 [Q99062-1]
GeneIDi1441
KEGGihsa:1441
UCSCiuc001cav.3 human [Q99062-1]

Organism-specific databases

CTDi1441
DisGeNETi1441
EuPathDBiHostDB:ENSG00000119535.17
GeneCardsiCSF3R
HGNCiHGNC:2439 CSF3R
HPAiCAB017116
HPA048086
MalaCardsiCSF3R
MIMi138971 gene
162830 phenotype
617014 phenotype
neXtProtiNX_Q99062
OpenTargetsiENSG00000119535
Orphaneti98824 Atypical chronic myeloid leukemia
420702 Autosomal recessive severe congenital neutropenia due to CSF3R deficiency
86829 Chronic neutrophilic leukemia
279943 Hereditary neutrophilia
PharmGKBiPA26942
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGHT Eukaryota
ENOG410XVIU LUCA
GeneTreeiENSGT00550000074436
HOGENOMiHOG000231142
HOVERGENiHBG051130
InParanoidiQ99062
KOiK05061
OMAiVQAYVLQ
OrthoDBiEOG091G01XM
PhylomeDBiQ99062
TreeFamiTF338122

Enzyme and pathway databases

ReactomeiR-HSA-449836 Other interleukin signaling
SignaLinkiQ99062
SIGNORiQ99062

Miscellaneous databases

ChiTaRSiCSF3R human
EvolutionaryTraceiQ99062
GeneWikiiGranulocyte_colony-stimulating_factor_receptor
GenomeRNAii1441
PROiPR:Q99062
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000119535 Expressed in 145 organ(s), highest expression level in blood
CleanExiHS_CSF3R
ExpressionAtlasiQ99062 baseline and differential
GenevisibleiQ99062 HS

Family and domain databases

CDDicd00063 FN3, 4 hits
Gene3Di2.60.40.10, 6 hits
InterProiView protein in InterPro
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR003529 Hematopoietin_rcpt_Gp130_CS
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR010457 IgC2-like_lig-bd
PfamiView protein in Pfam
PF00041 fn3, 1 hit
PF06328 Lep_receptor_Ig, 1 hit
SMARTiView protein in SMART
SM00060 FN3, 5 hits
SUPFAMiSSF48726 SSF48726, 1 hit
SSF49265 SSF49265, 4 hits
PROSITEiView protein in PROSITE
PS50853 FN3, 5 hits
PS01353 HEMATOPO_REC_L_F2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCSF3R_HUMAN
AccessioniPrimary (citable) accession number: Q99062
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 1, 1995
Last sequence update: February 1, 1995
Last modified: November 7, 2018
This is version 187 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again