Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q96T55 (KCNKG_HUMAN)

Entry version 151 (29 Sep 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Potassium channel subfamily K member 16

Gene

KCNK16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K+ currents.

Miscellaneous

Inhibited by Ba2+, quinine, quinidine, chloroform and halothane. Activated at alkaline pH.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandPotassium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96T55

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1299361, TWIK-related alkaline pH activated K+ channel (TALK)
R-HSA-5576886, Phase 4 - resting membrane potential

Protein family/group databases

Transport Classification Database

More...TCDBi		1.A.1.9.10, the voltage-gated ion channel (vic) superfamily

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Potassium channel subfamily K member 16
Alternative name(s):
2P domain potassium channel Talk-1
TWIK-related alkaline pH-activated K(+) channel 1
Short name:
TALK-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KCNK16
Synonyms:TALK1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:14464, KCNK16

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607369, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96T55

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000095981

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 13CytoplasmicSequence analysisAdd BLAST13
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei14 – 34HelicalSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei98 – 116Pore-forming; Name=Pore-forming 1Sequence analysisAdd BLAST19
Transmembranei120 – 140HelicalSequence analysisAdd BLAST21
Topological domaini141 – 165CytoplasmicSequence analysisAdd BLAST25
Transmembranei166 – 186HelicalSequence analysisAdd BLAST21
Intramembranei202 – 221Pore-forming; Name=Pore-forming 2Sequence analysisAdd BLAST20
Transmembranei238 – 258HelicalSequence analysisAdd BLAST21
Topological domaini259 – 309CytoplasmicSequence analysisAdd BLAST51

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		83795

Open Targets

More...OpenTargetsi		ENSG00000095981

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA30057

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96T55, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KCNK16

Domain mapping of disease mutations (DMDM)

More...DMDMi		24636281

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001017671 – 309Potassium channel subfamily K member 16Add BLAST309

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96T55

PRoteomics IDEntifications database

More...PRIDEi		Q96T55

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78192 [Q96T55-1]
78193 [Q96T55-3]
78194 [Q96T55-4]
78195 [Q96T55-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96T55

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96T55

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in pancreas. Not detectable in the other tissues tested.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000095981, Expressed in islet of Langerhans and 29 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96T55, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96T55, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000095981, Tissue enhanced (pancreas, stomach)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Curated

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123763, 27 interactors

Protein interaction database and analysis system

More...IntActi		Q96T55, 15 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000391498

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96T55, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. [View classification]Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1418, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159813

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_022504_6_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96T55

Identification of Orthologs from Complete Genome Data

More...OMAi		YGEGFYF

Database of Orthologous Groups

More...OrthoDBi		897327at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96T55

TreeFam database of animal gene trees

More...TreeFami		TF313947

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR003280, 2pore_dom_K_chnl
IPR003092, 2pore_dom_K_chnl_TASK
IPR013099, K_chnl_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07885, Ion_trans_2, 2 hits

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01333, 2POREKCHANEL
PR01095, TASKCHANNEL

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform a (identifier: Q96T55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSAGLCSCW GGRVLPLLLA YVCYLLLGAT IFQLLERQAE AQSRDQFQLE 
        60         70         80         90        100
KLRFLENYTC LDQWAMEQFV QVIMEAWVKG VNPKGNSTNP SNWDFGSSFF 
       110        120        130        140        150
FAGTVVTTIG YGNLAPSTEA GQVFCVFYAL LGIPLNVIFL NHLGTGLRAH 
       160        170        180        190        200
LAAIERWEDR PRRSQVLQVL GLALFLTLGT LVILIFPPMV FSHVEGWSFS 
       210        220        230        240        250
EGFYFAFITL STIGFGDYVV GTDPSKHYIS VYRSLAAIWI LLGLAWLALI 
       260        270        280        290        300
LPLGPLLLHR CCQLWLLSLR QGCGAKAAPG RRPRRGSTAA RGVQVTPQDF 

PISKKGLGS
Length:309
Mass (Da):34,153
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i99C4B11EB26B0764
GO
Isoform b (identifier: Q96T55-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     269-309: LRQGCGAKAAPGRRPRRGSTAARGVQVTPQDFPISKKGLGS → RGLGVKDGAASDPSGLPRPQKIPISA

Show »
Length:294
Mass (Da):32,507
Checksum:iFCBA3B352F1F0952
GO
Isoform c (identifier: Q96T55-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-309: TDPSKHYISV...FPISKKGLGS → HPLNFITPSG...PMWLGSSAQV

Show »
Length:322
Mass (Da):35,802
Checksum:i58B8EA53875CD2F5
GO
Isoform d (identifier: Q96T55-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     222-268: Missing.

Show »
Length:262
Mass (Da):28,828
Checksum:i56C1DF119F5931F3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RC57D6RC57_HUMAN
Potassium channel subfamily K membe...
KCNK16
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti49L → S in AAP82866 (PubMed:12724142).Curated1
Sequence conflicti149A → V in AAP82867 (PubMed:12724142).Curated1
Sequence conflicti200S → G in AAP82866 (PubMed:12724142).Curated1
Sequence conflicti205 – 207FAF → LLS in AAP82867 (PubMed:12724142).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_063636215F → L. Corresponds to variant dbSNP:rs9462527Ensembl.1
Natural variantiVAR_063637275A → G. Corresponds to variant dbSNP:rs1535500Ensembl.1
Natural variantiVAR_052430301P → H2 PublicationsCorresponds to variant dbSNP:rs11756091Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039863222 – 309TDPSK…KGLGS → HPLNFITPSGLLPSQEPFQT PHGKPESQQIPGSFQKVSSM NVWPLSGMHSPGLAFPLPDC NIPDQERFRPLHPGAWKFWP LPLPSSNSKWAPMWLGSSAQ V in isoform c. 2 PublicationsAdd BLAST88
Alternative sequenceiVSP_039864222 – 268Missing in isoform d. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_039865269 – 309LRQGC…KGLGS → RGLGVKDGAASDPSGLPRPQ KIPISA in isoform b. 2 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF358909 mRNA Translation: AAK49532.1
AY253145 mRNA Translation: AAP82866.1
AY253146 mRNA Translation: AAP82867.1
AY253147 mRNA Translation: AAP82868.1
EU978943 mRNA Translation: ACH86102.1
AL136087 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03982.1
CH471081 Genomic DNA Translation: EAX03984.1
CH471081 Genomic DNA Translation: EAX03985.1
BC111860 mRNA Translation: AAI11861.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47420.1 [Q96T55-5]
CCDS47421.1 [Q96T55-4]
CCDS47422.1 [Q96T55-3]
CCDS4843.1 [Q96T55-1]

NCBI Reference Sequences

More...RefSeqi		NP_001128577.1, NM_001135105.1 [Q96T55-4]
NP_001128578.1, NM_001135106.1 [Q96T55-3]
NP_001128579.1, NM_001135107.1 [Q96T55-5]
NP_115491.1, NM_032115.3 [Q96T55-1]
XP_016866835.1, XM_017011346.1 [Q96T55-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000373227; ENSP00000362324; ENSG00000095981 [Q96T55-5]
ENST00000373229; ENSP00000362326; ENSG00000095981 [Q96T55-1]
ENST00000425054; ENSP00000391498; ENSG00000095981 [Q96T55-4]
ENST00000437525; ENSP00000415375; ENSG00000095981 [Q96T55-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		83795

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:83795

UCSC genome browser

More...UCSCi		uc003ooq.3, human [Q96T55-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF358909 mRNA Translation: AAK49532.1
AY253145 mRNA Translation: AAP82866.1
AY253146 mRNA Translation: AAP82867.1
AY253147 mRNA Translation: AAP82868.1
EU978943 mRNA Translation: ACH86102.1
AL136087 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03982.1
CH471081 Genomic DNA Translation: EAX03984.1
CH471081 Genomic DNA Translation: EAX03985.1
BC111860 mRNA Translation: AAI11861.1
CCDSiCCDS47420.1 [Q96T55-5]
CCDS47421.1 [Q96T55-4]
CCDS47422.1 [Q96T55-3]
CCDS4843.1 [Q96T55-1]
RefSeqiNP_001128577.1, NM_001135105.1 [Q96T55-4]
NP_001128578.1, NM_001135106.1 [Q96T55-3]
NP_001128579.1, NM_001135107.1 [Q96T55-5]
NP_115491.1, NM_032115.3 [Q96T55-1]
XP_016866835.1, XM_017011346.1 [Q96T55-5]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi123763, 27 interactors
IntActiQ96T55, 15 interactors
STRINGi9606.ENSP00000391498

Protein family/group databases

TCDBi1.A.1.9.10, the voltage-gated ion channel (vic) superfamily

PTM databases

iPTMnetiQ96T55
PhosphoSitePlusiQ96T55

Genetic variation databases

BioMutaiKCNK16
DMDMi24636281

Proteomic databases

PaxDbiQ96T55
PRIDEiQ96T55
ProteomicsDBi78192 [Q96T55-1]
78193 [Q96T55-3]
78194 [Q96T55-4]
78195 [Q96T55-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		15706, 41 antibodies

The DNASU plasmid repository

More...DNASUi		83795

Genome annotation databases

EnsembliENST00000373227; ENSP00000362324; ENSG00000095981 [Q96T55-5]
ENST00000373229; ENSP00000362326; ENSG00000095981 [Q96T55-1]
ENST00000425054; ENSP00000391498; ENSG00000095981 [Q96T55-4]
ENST00000437525; ENSP00000415375; ENSG00000095981 [Q96T55-3]
GeneIDi83795
KEGGihsa:83795
UCSCiuc003ooq.3, human [Q96T55-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		83795
DisGeNETi83795

GeneCards: human genes, protein and diseases

More...GeneCardsi		KCNK16
HGNCiHGNC:14464, KCNK16
HPAiENSG00000095981, Tissue enhanced (pancreas, stomach)
MIMi607369, gene
neXtProtiNX_Q96T55
OpenTargetsiENSG00000095981
PharmGKBiPA30057
VEuPathDBiHostDB:ENSG00000095981

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1418, Eukaryota
GeneTreeiENSGT00940000159813
HOGENOMiCLU_022504_6_0_1
InParanoidiQ96T55
OMAiYGEGFYF
OrthoDBi897327at2759
PhylomeDBiQ96T55
TreeFamiTF313947

Enzyme and pathway databases

PathwayCommonsiQ96T55
ReactomeiR-HSA-1299361, TWIK-related alkaline pH activated K+ channel (TALK)
R-HSA-5576886, Phase 4 - resting membrane potential

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		83795, 7 hits in 999 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		KCNK16

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		83795
PharosiQ96T55, Tbio

Protein Ontology

More...PROi		PR:Q96T55
RNActiQ96T55, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000095981, Expressed in islet of Langerhans and 29 other tissues
ExpressionAtlasiQ96T55, baseline and differential
GenevisibleiQ96T55, HS

Family and domain databases

InterProiView protein in InterPro
IPR003280, 2pore_dom_K_chnl
IPR003092, 2pore_dom_K_chnl_TASK
IPR013099, K_chnl_dom
PfamiView protein in Pfam
PF07885, Ion_trans_2, 2 hits
PRINTSiPR01333, 2POREKCHANEL
PR01095, TASKCHANNEL

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCNKG_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96T55
Secondary accession number(s): B5TJL9
, Q2M2N9, Q5TCF3, Q6X6Z3, Q6X6Z4, Q6X6Z5, Q9H591
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 2002
Last sequence update: December 1, 2001
Last modified: September 29, 2021
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again