Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96S90 (LYSM1_HUMAN)

Entry version 145 (02 Dec 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

LysM and putative peptidoglycan-binding domain-containing protein 1

Gene

LYSMD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96S90

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LysM and putative peptidoglycan-binding domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LYSMD1
ORF Names:SB145
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000163155.11

Human Gene Nomenclature Database

More...HGNCi		HGNC:32070, LYSMD1

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96S90

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000163155

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671493

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96S90, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		LYSMD1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74752122

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002479961 – 227LysM and putative peptidoglycan-binding domain-containing protein 1Add BLAST227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei23PhosphoserineCombined sources1
Modified residuei33PhosphoserineCombined sources1
Modified residuei99PhosphoserineCombined sources1
Modified residuei166PhosphoserineCombined sources1
Modified residuei194PhosphoserineBy similarity1
Modified residuei212PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96S90

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96S90

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96S90

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96S90

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96S90

PeptideAtlas

More...PeptideAtlasi		Q96S90

PRoteomics IDEntifications database

More...PRIDEi		Q96S90

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		78085 [Q96S90-1]
78086 [Q96S90-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96S90

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96S90

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000163155, Expressed in amniotic fluid and 164 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96S90, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000163155, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		132813, 12 interactors

Protein interaction database and analysis system

More...IntActi		Q96S90, 14 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000357904

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96S90, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1227
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96S90

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q96S90

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini40 – 84LysMPROSITE-ProRule annotationAdd BLAST45

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502RZER, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160002

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_079453_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96S90

Identification of Orthologs from Complete Genome Data

More...OMAi		KGCQEAE

Database of Orthologous Groups

More...OrthoDBi		1553362at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96S90

TreeFam database of animal gene trees

More...TreeFami		TF318444

Family and domain databases

Conserved Domains Database

More...CDDi		cd00118, LysM, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.10.350.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR018392, LysM_dom
IPR036779, LysM_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01476, LysM, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00257, LysM, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51782, LYSM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96S90-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASPSRQPPP GGSGLLQGSR ARSYGSLVQS ACSPVRERRL EHQLEPGDTL 
        60         70         80         90        100
AGLALKYGVT MEQIKRANRL YTNDSIFLKK TLYIPILTEP RDLFNGLDSE 
       110        120        130        140        150
EEKDGEEKVH PSNSEVWPHS TERKKQETGA GRANGEVLPT PGQETPTPIH 
       160        170        180        190        200
DLSASDFLKK LDSQISLSKK AAAQKLKKGE NGVPGEDAGL HLSSPWMQQR 
       210        220 
AVLGPVPLTR TSRTRTLRDQ EDEIFKL
Length:227
Mass (Da):25,003
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3F119652D42F224F
GO
Isoform 2 (identifier: Q96S90-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVT → MRSGPLRISEWK

Show »
Length:179
Mass (Da):20,171
Checksum:i3490AA3ACB0F1AE9
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAH10716 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti128T → G in CAH10716 (PubMed:17974005).Curated1
Sequence conflicti164Q → R in BAG60863 (PubMed:14702039).Curated1
Sequence conflicti198Q → R in CAH10716 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0410831 – 60MASPS…KYGVT → MRSGPLRISEWK in isoform 2. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY037156 mRNA Translation: AAK67635.1
AK298706 mRNA Translation: BAG60863.1
AL122088 mRNA Translation: CAH10716.1 Different initiation.
BX647911 mRNA Translation: CAH10574.1
AL592424 Genomic DNA No translation available.
BC031649 mRNA Translation: AAH31649.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44218.1 [Q96S90-2]
CCDS986.1 [Q96S90-1]

NCBI Reference Sequences

More...RefSeqi		NP_001130015.1, NM_001136543.1 [Q96S90-2]
NP_997716.1, NM_212551.4 [Q96S90-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000368908; ENSP00000357904; ENSG00000163155 [Q96S90-1]
ENST00000440902; ENSP00000404059; ENSG00000163155 [Q96S90-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		388695

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:388695

UCSC genome browser

More...UCSCi		uc001ewy.4, human [Q96S90-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY037156 mRNA Translation: AAK67635.1
AK298706 mRNA Translation: BAG60863.1
AL122088 mRNA Translation: CAH10716.1 Different initiation.
BX647911 mRNA Translation: CAH10574.1
AL592424 Genomic DNA No translation available.
BC031649 mRNA Translation: AAH31649.1
CCDSiCCDS44218.1 [Q96S90-2]
CCDS986.1 [Q96S90-1]
RefSeqiNP_001130015.1, NM_001136543.1 [Q96S90-2]
NP_997716.1, NM_212551.4 [Q96S90-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DJPNMR-A32-95[»]
SMRiQ96S90
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi132813, 12 interactors
IntActiQ96S90, 14 interactors
STRINGi9606.ENSP00000357904

PTM databases

iPTMnetiQ96S90
PhosphoSitePlusiQ96S90

Polymorphism and mutation databases

BioMutaiLYSMD1
DMDMi74752122

Proteomic databases

EPDiQ96S90
jPOSTiQ96S90
MassIVEiQ96S90
MaxQBiQ96S90
PaxDbiQ96S90
PeptideAtlasiQ96S90
PRIDEiQ96S90
ProteomicsDBi78085 [Q96S90-1]
78086 [Q96S90-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		34054, 113 antibodies

The DNASU plasmid repository

More...DNASUi		388695

Genome annotation databases

EnsembliENST00000368908; ENSP00000357904; ENSG00000163155 [Q96S90-1]
ENST00000440902; ENSP00000404059; ENSG00000163155 [Q96S90-2]
GeneIDi388695
KEGGihsa:388695
UCSCiuc001ewy.4, human [Q96S90-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		388695
EuPathDBiHostDB:ENSG00000163155.11

GeneCards: human genes, protein and diseases

More...GeneCardsi		LYSMD1
HGNCiHGNC:32070, LYSMD1
HPAiENSG00000163155, Low tissue specificity
neXtProtiNX_Q96S90
OpenTargetsiENSG00000163155
PharmGKBiPA142671493

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502RZER, Eukaryota
GeneTreeiENSGT00940000160002
HOGENOMiCLU_079453_0_0_1
InParanoidiQ96S90
OMAiKGCQEAE
OrthoDBi1553362at2759
PhylomeDBiQ96S90
TreeFamiTF318444

Enzyme and pathway databases

PathwayCommonsiQ96S90

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		388695, 11 hits in 842 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		LYSMD1, human
EvolutionaryTraceiQ96S90

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		388695
PharosiQ96S90, Tdark

Protein Ontology

More...PROi		PR:Q96S90
RNActiQ96S90, protein

Gene expression databases

BgeeiENSG00000163155, Expressed in amniotic fluid and 164 other tissues
GenevisibleiQ96S90, HS

Family and domain databases

CDDicd00118, LysM, 1 hit
Gene3Di3.10.350.10, 1 hit
InterProiView protein in InterPro
IPR018392, LysM_dom
IPR036779, LysM_dom_sf
PfamiView protein in Pfam
PF01476, LysM, 1 hit
SMARTiView protein in SMART
SM00257, LysM, 1 hit
PROSITEiView protein in PROSITE
PS51782, LYSM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLYSM1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96S90
Secondary accession number(s): B4DQA1, Q69YX9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: December 1, 2001
Last modified: December 2, 2020
This is version 145 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again