Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BRCA1-A complex subunit RAP80

Gene

UIMC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Ubiquitin-binding protein (PubMed:24627472). Specifically recognizes and binds 'Lys-63'-linked ubiquitin (PubMed:19328070, Ref. 37). Plays a central role in the BRCA1-A complex by specifically binding 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. Also weakly binds monoubiquitin but with much less affinity than 'Lys-63'-linked ubiquitin. May interact with monoubiquitinated histones H2A and H2B; the relevance of such results is however unclear in vivo. Does not bind Lys-48'-linked ubiquitin. May indirectly act as a transcriptional repressor by inhibiting the interaction of NR6A1 with the corepressor NCOR1.12 Publications

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator
Biological processDNA damage, DNA repair, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-5689901 Metalloprotease DUBs
R-HSA-5693565 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
R-HSA-5693571 Nonhomologous End-Joining (NHEJ)
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-69473 G2/M DNA damage checkpoint
SIGNORiQ96RL1

Names & Taxonomyi

Protein namesi
Recommended name:
BRCA1-A complex subunit RAP80
Alternative name(s):
Receptor-associated protein 80
Retinoid X receptor-interacting protein 110
Ubiquitin interaction motif-containing protein 1
Gene namesi
Name:UIMC1
Synonyms:RAP80, RXRIP110
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000087206.16
HGNCiHGNC:30298 UIMC1
MIMi609433 gene
neXtProtiNX_Q96RL1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi9K → A: Does not affect symoylation; when associated with A-19; A-31; A-52 and A-61. 1 Publication1
Mutagenesisi19K → A: Does not affect symoylation; when associated with A-9; A-31; A-52 and A-61. 1 Publication1
Mutagenesisi31K → A: Does not affect symoylation; when associated with A-9; A-19; A-52 and A-61. 1 Publication1
Mutagenesisi52K → A: Does not affect symoylation; when associated with A-9; A-19; A-31 and A-61. 1 Publication1
Mutagenesisi61K → A: Does not affect symoylation; when associated with A-9; A-19; A-31 and A-52. 1 Publication1
Mutagenesisi81Missing : Strongly reduces ubiquitin binding via UIM 1. 1 Publication1
Mutagenesisi88A → G or S: Impairs localization to DNA damages sites; when associated with A-92; S-113 and A-117. 3 Publications1
Mutagenesisi92S → A: Impairs localization to DNA damages sites; when associated with S-88; S-113 and A-117. 2 Publications1
Mutagenesisi97 – 103REVNSQE → AA: Impairs the selectivity for 'K-63'-linked ubiquitin. 1 Publication7
Mutagenesisi97 – 103REVNSQE → AAAAAAA: Increases the selectivity for 'K-63'-linked ubiquitin. 1 Publication7
Mutagenesisi97 – 103REVNSQE → AAAAAAAAA: Impairs the selectivity for 'K-63'-linked ubiquitin. 1 Publication7
Mutagenesisi101S → A or E: Slightly impairs the selectivity for 'K-63'-linked ubiquitin. 1 Publication1
Mutagenesisi113A → G or S: Impairs ubiquitin-binding and localization to DNA damages sites; when associated with S-88; A-92 and A-117. 3 Publications1
Mutagenesisi117S → A: Impairs ubiquitin-binding and localization to DNA damages sites; when associated with S-88; A-92 and S-113. 2 Publications1
Mutagenesisi205S → G: Abolishes phosphorylation at this position. 1 Publication1
Mutagenesisi508C → A: Abolishes interaction with histone monoubiquitinated H2B without affecting the interaction with H2A. 1 Publication1

Organism-specific databases

DisGeNETi51720
OpenTargetsiENSG00000087206
PharmGKBiPA162408624

Polymorphism and mutation databases

BioMutaiUIMC1
DMDMi60390957

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000975471 – 719BRCA1-A complex subunit RAP80Add BLAST719

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei29PhosphoserineCombined sources1
Cross-linki31Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei44PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Cross-linki75Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki90Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei101PhosphoserineCombined sources2 Publications1
Modified residuei140PhosphoserineCombined sources1 Publication1
Cross-linki188Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei205Phosphoserine2 Publications1
Cross-linki245Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei379PhosphoserineBy similarity1
Cross-linki382Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki387Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei402Phosphoserine2 Publications1
Modified residuei419Phosphoserine1 Publication1
Cross-linki428Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei466PhosphoserineCombined sources1
Cross-linki544Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki559Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki562Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki587Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki607Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei627PhosphoserineCombined sources1
Cross-linki635Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki642Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei653PhosphoserineCombined sources1
Modified residuei677PhosphoserineCombined sources1
Cross-linki696Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki697Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Post-translational modificationi

Sumoylated.1 Publication
Phosphorylated upon DNA damage by ATM or ATR.5 Publications

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ96RL1
MaxQBiQ96RL1
PaxDbiQ96RL1
PeptideAtlasiQ96RL1
PRIDEiQ96RL1
ProteomicsDBi77977
77978 [Q96RL1-2]
77979 [Q96RL1-3]
77980 [Q96RL1-4]
77981 [Q96RL1-5]

PTM databases

iPTMnetiQ96RL1
PhosphoSitePlusiQ96RL1

Expressioni

Tissue specificityi

Expressed in testis, ovary, thymus and heart. Expressed in germ cells of the testis.1 Publication

Gene expression databases

BgeeiENSG00000087206 Expressed in 209 organ(s), highest expression level in testis
CleanExiHS_UIMC1
ExpressionAtlasiQ96RL1 baseline and differential
GenevisibleiQ96RL1 HS

Organism-specific databases

HPAiHPA037503
HPA037504

Interactioni

Subunit structurei

Interacts with TSP57 (By similarity). Component of the ARISC complex, at least composed of UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1 (PubMed:24075985). Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with ABRAXAS1. Interacts with ESR1, NR6A1 and UBE2I.By similarity11 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119697, 74 interactors
CORUMiQ96RL1
DIPiDIP-29936N
IntActiQ96RL1, 51 interactors
MINTiQ96RL1
STRINGi9606.ENSP00000366434

Structurei

Secondary structure

1719
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ96RL1
SMRiQ96RL1
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96RL1

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini80 – 99UIM 1PROSITE-ProRule annotationAdd BLAST20
Domaini105 – 124UIM 2PROSITE-ProRule annotationAdd BLAST20

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 101Necessary for transcriptional repressionAdd BLAST101
Regioni97 – 103UIM-linker7
Regioni100 – 200Necessary for interaction with NR6A1 N-terminusAdd BLAST101
Regioni270 – 400AIRAdd BLAST131
Regioni400 – 500Necessary for interaction with NR6A1 C-terminusAdd BLAST101
Regioni505 – 582Zinc-finger-like regionAdd BLAST78

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi60 – 78LR motifAdd BLAST19

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi81 – 108Glu-richAdd BLAST28

Domaini

The tandem UIM domains form a continuous 60 Angstrom-long alpha-helix and mediate binding to 'Lys-63'-linked ubiquitins. UIM1 and UIM2 bind to the proximal and distal ubiquitin moieties and recognize an 'Ile-44'-centered hydrophobic patch. Since UIMs don't interact with the 'Lys-63' isopeptide bond the UIM-linker region between the 2 UIM domains determines the selectivity for 'Lys-63'-linkage, and its length is very important for specificity.By similarity3 Publications
The Abraxas-interacting region (AIR) mediates the interaction with ABRAXAS1.1 Publication

Sequence similaritiesi

Belongs to the RAP80 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IGE5 Eukaryota
ENOG4111MI8 LUCA
GeneTreeiENSGT00390000007635
HOVERGENiHBG056783
InParanoidiQ96RL1
KOiK20775
OMAiAEHTQCG
OrthoDBiEOG091G07P7
PhylomeDBiQ96RL1
TreeFamiTF336575

Family and domain databases

InterProiView protein in InterPro
IPR038868 RAP80
IPR003903 UIM_dom
PANTHERiPTHR15932 PTHR15932, 1 hit
SMARTiView protein in SMART
SM00726 UIM, 2 hits
PROSITEiView protein in PROSITE
PS50330 UIM, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96RL1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRRKKKVKE VSESRNLEKK DVETTSSVSV KRKRRLEDAF IVISDSDGEE
60 70 80 90 100
PKEENGLQKT KTKQSNRAKC LAKRKIAQMT EEEQFALALK MSEQEAREVN
110 120 130 140 150
SQEEEEEELL RKAIAESLNS CRPSDASATR SRPLATGPSS QSHQEKTTDS
160 170 180 190 200
GLTEGIWQLV PPSLFKGSHI SQGNEAEERE EPWDHTEKTE EEPVSGSSGS
210 220 230 240 250
WDQSSQPVFE NVNVKSFDRC TGHSAEHTQC GKPQESTGRG SAFLKAVQGS
260 270 280 290 300
GDTSRHCLPT LADAKGLQDT GGTVNYFWGI PFCPDGVDPN QYTKVILCQL
310 320 330 340 350
EVYQKSLKMA QRQLLNKKGF GEPVLPRPPS LIQNECGQGE QASEKNECIS
360 370 380 390 400
EDMGDEDKEE RQESRASDWH SKTKDFQESS IKSLKEKLLL EEEPTTSHGQ
410 420 430 440 450
SSQGIVEETS EEGNSVPASQ SVAALTSKRS LVLMPESSAE EITVCPETQL
460 470 480 490 500
SSSETFDLER EVSPGSRDIL DGVRIIMADK EVGNKEDAEK EVAISTFSSS
510 520 530 540 550
NQVSCPLCDQ CFPPTKIERH AMYCNGLMEE DTVLTRRQKE AKTKSDSGTA
560 570 580 590 600
AQTSLDIDKN EKCYLCKSLV PFREYQCHVD SCLQLAKADQ GDGPEGSGRA
610 620 630 640 650
CSTVEGKWQQ RLKNPKEKGH SEGRLLSFLE QSEHKTSDAD IKSSETGAFR
660 670 680 690 700
VPSPGMEEAG CSREMQSSFT RRDLNESPVK SFVSISEATD CLVDFKKQVT
710
VQPGSRTRTK AGRGRRRKF
Length:719
Mass (Da):79,727
Last modified:March 1, 2005 - v2
Checksum:i56B7699E42395861
GO
Isoform 2 (identifier: Q96RL1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     234-399: Missing.

Show »
Length:553
Mass (Da):61,325
Checksum:i61E2037D20BB900B
GO
Isoform 3 (identifier: Q96RL1-3) [UniParc]FASTAAdd to basket
Also known as: XHRIP110

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Show »
Length:641
Mass (Da):70,744
Checksum:i62A782DFDA0E30AD
GO
Isoform 4 (identifier: Q96RL1-4) [UniParc]FASTAAdd to basket
Also known as: X2HRIP110

The sequence of this isoform differs from the canonical sequence as follows:
     1-370: Missing.
     371-400: SKTKDFQESSIKSLKEKLLLEEEPTTSHGQ → MLPLPDLDLWPLDRLPSPIKRKPQTLGSLK

Show »
Length:349
Mass (Da):38,477
Checksum:iF6A39455A3642247
GO
Isoform 5 (identifier: Q96RL1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     120-152: SCRPSDASATRSRPLATGPSSQSHQEKTTDSGL → VNMPCCKSLWRLISYIFDFCGVVVALGTSCSHL
     153-719: Missing.

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):17,412
Checksum:iC0CB4F0EBE4ADA49
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RC40D6RC40_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
157Annotation score:
D6RCQ3D6RCQ3_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
166Annotation score:
D6RDZ5D6RDZ5_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
89Annotation score:
D6R9M3D6R9M3_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
31Annotation score:

Sequence cautioni

The sequence AAH06078 differs from that shown. Reason: Erroneous termination at position 386. Translated as Glu.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti187E → K in AAH06078 (PubMed:15489334).Curated1
Sequence conflicti192E → G in BAG51153 (PubMed:14702039).Curated1
Sequence conflicti247V → C in AAG59851 (Ref. 3) Curated1
Sequence conflicti347E → G in AAK61871 (PubMed:12080054).Curated1
Sequence conflicti518E → G in AAK61871 (PubMed:12080054).Curated1
Sequence conflicti634H → R in AAG59855 (Ref. 3) Curated1
Sequence conflicti638D → N in BAG51153 (PubMed:14702039).Curated1
Sequence conflicti694D → V in AAG59855 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05146915R → W Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs13167812Ensembl.1
Natural variantiVAR_055328353M → T Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs143282828Ensembl.1
Natural variantiVAR_051470435P → L Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs3733876Ensembl.1
Natural variantiVAR_051471511C → R Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs13360277Ensembl.1
Natural variantiVAR_051472596G → E. Corresponds to variant dbSNP:rs10475633Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0129331 – 370Missing in isoform 4. 2 PublicationsAdd BLAST370
Alternative sequenceiVSP_0129321 – 78Missing in isoform 3. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_037264120 – 152SCRPS…TDSGL → VNMPCCKSLWRLISYIFDFC GVVVALGTSCSHL in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_037265153 – 719Missing in isoform 5. 1 PublicationAdd BLAST567
Alternative sequenceiVSP_012935234 – 399Missing in isoform 2. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_012934371 – 400SKTKD…TSHGQ → MLPLPDLDLWPLDRLPSPIK RKPQTLGSLK in isoform 4. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF349313 mRNA Translation: AAK61871.1
AF113538 mRNA Translation: AAF14875.1
AF284749 mRNA Translation: AAG59851.1
AF284753 mRNA Translation: AAG59855.1
AK023044 mRNA Translation: BAG51153.1
AK304794 mRNA Translation: BAG65544.1
BX537376 mRNA Translation: CAD97618.1
AC027318 Genomic DNA No translation available.
BC006078 mRNA Translation: AAH06078.1 Different termination.
BC032561 mRNA Translation: AAH32561.1
CCDSiCCDS4408.1 [Q96RL1-1]
CCDS83050.1 [Q96RL1-2]
RefSeqiNP_001186226.1, NM_001199297.2 [Q96RL1-1]
NP_001186227.1, NM_001199298.1 [Q96RL1-1]
NP_001304890.1, NM_001317961.1 [Q96RL1-2]
NP_057374.3, NM_016290.4 [Q96RL1-1]
XP_005265987.1, XM_005265930.2 [Q96RL1-1]
XP_005265993.1, XM_005265936.2 [Q96RL1-4]
XP_006714934.1, XM_006714871.2 [Q96RL1-1]
XP_016865063.1, XM_017009574.1 [Q96RL1-3]
XP_016865067.1, XM_017009578.1 [Q96RL1-4]
XP_016865068.1, XM_017009579.1 [Q96RL1-4]
UniGeneiHs.232721

Genome annotation databases

EnsembliENST00000377227; ENSP00000366434; ENSG00000087206 [Q96RL1-1]
ENST00000506128; ENSP00000427480; ENSG00000087206 [Q96RL1-2]
ENST00000510698; ENSP00000423717; ENSG00000087206 [Q96RL1-4]
ENST00000511320; ENSP00000421926; ENSG00000087206 [Q96RL1-1]
GeneIDi51720
KEGGihsa:51720
UCSCiuc063kam.1 human [Q96RL1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF349313 mRNA Translation: AAK61871.1
AF113538 mRNA Translation: AAF14875.1
AF284749 mRNA Translation: AAG59851.1
AF284753 mRNA Translation: AAG59855.1
AK023044 mRNA Translation: BAG51153.1
AK304794 mRNA Translation: BAG65544.1
BX537376 mRNA Translation: CAD97618.1
AC027318 Genomic DNA No translation available.
BC006078 mRNA Translation: AAH06078.1 Different termination.
BC032561 mRNA Translation: AAH32561.1
CCDSiCCDS4408.1 [Q96RL1-1]
CCDS83050.1 [Q96RL1-2]
RefSeqiNP_001186226.1, NM_001199297.2 [Q96RL1-1]
NP_001186227.1, NM_001199298.1 [Q96RL1-1]
NP_001304890.1, NM_001317961.1 [Q96RL1-2]
NP_057374.3, NM_016290.4 [Q96RL1-1]
XP_005265987.1, XM_005265930.2 [Q96RL1-1]
XP_005265993.1, XM_005265936.2 [Q96RL1-4]
XP_006714934.1, XM_006714871.2 [Q96RL1-1]
XP_016865063.1, XM_017009574.1 [Q96RL1-3]
XP_016865067.1, XM_017009578.1 [Q96RL1-4]
XP_016865068.1, XM_017009579.1 [Q96RL1-4]
UniGeneiHs.232721

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MKFNMR-A74-131[»]
2MKGNMR-A74-131[»]
2N9ENMR-A37-49[»]
2RR9NMR-C79-124[»]
ProteinModelPortaliQ96RL1
SMRiQ96RL1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119697, 74 interactors
CORUMiQ96RL1
DIPiDIP-29936N
IntActiQ96RL1, 51 interactors
MINTiQ96RL1
STRINGi9606.ENSP00000366434

PTM databases

iPTMnetiQ96RL1
PhosphoSitePlusiQ96RL1

Polymorphism and mutation databases

BioMutaiUIMC1
DMDMi60390957

Proteomic databases

EPDiQ96RL1
MaxQBiQ96RL1
PaxDbiQ96RL1
PeptideAtlasiQ96RL1
PRIDEiQ96RL1
ProteomicsDBi77977
77978 [Q96RL1-2]
77979 [Q96RL1-3]
77980 [Q96RL1-4]
77981 [Q96RL1-5]

Protocols and materials databases

DNASUi51720
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377227; ENSP00000366434; ENSG00000087206 [Q96RL1-1]
ENST00000506128; ENSP00000427480; ENSG00000087206 [Q96RL1-2]
ENST00000510698; ENSP00000423717; ENSG00000087206 [Q96RL1-4]
ENST00000511320; ENSP00000421926; ENSG00000087206 [Q96RL1-1]
GeneIDi51720
KEGGihsa:51720
UCSCiuc063kam.1 human [Q96RL1-1]

Organism-specific databases

CTDi51720
DisGeNETi51720
EuPathDBiHostDB:ENSG00000087206.16
GeneCardsiUIMC1
H-InvDBiHIX0005450
HGNCiHGNC:30298 UIMC1
HPAiHPA037503
HPA037504
MIMi609433 gene
neXtProtiNX_Q96RL1
OpenTargetsiENSG00000087206
PharmGKBiPA162408624
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGE5 Eukaryota
ENOG4111MI8 LUCA
GeneTreeiENSGT00390000007635
HOVERGENiHBG056783
InParanoidiQ96RL1
KOiK20775
OMAiAEHTQCG
OrthoDBiEOG091G07P7
PhylomeDBiQ96RL1
TreeFamiTF336575

Enzyme and pathway databases

ReactomeiR-HSA-5689901 Metalloprotease DUBs
R-HSA-5693565 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
R-HSA-5693571 Nonhomologous End-Joining (NHEJ)
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-69473 G2/M DNA damage checkpoint
SIGNORiQ96RL1

Miscellaneous databases

ChiTaRSiUIMC1 human
EvolutionaryTraceiQ96RL1
GeneWikiiUIMC1
GenomeRNAii51720
PROiPR:Q96RL1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000087206 Expressed in 209 organ(s), highest expression level in testis
CleanExiHS_UIMC1
ExpressionAtlasiQ96RL1 baseline and differential
GenevisibleiQ96RL1 HS

Family and domain databases

InterProiView protein in InterPro
IPR038868 RAP80
IPR003903 UIM_dom
PANTHERiPTHR15932 PTHR15932, 1 hit
SMARTiView protein in SMART
SM00726 UIM, 2 hits
PROSITEiView protein in PROSITE
PS50330 UIM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUIMC1_HUMAN
AccessioniPrimary (citable) accession number: Q96RL1
Secondary accession number(s): A8MSA1
, B3KMZ1, B4E3N2, Q5XKQ1, Q7Z3W7, Q8N5B9, Q9BZR1, Q9BZR5, Q9UHX7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: March 1, 2005
Last modified: September 12, 2018
This is version 145 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again