Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (18 Sep 2019)
Sequence version 2 (01 Mar 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

BRCA1-A complex subunit RAP80

Gene

UIMC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Ubiquitin-binding protein (PubMed:24627472). Specifically recognizes and binds 'Lys-63'-linked ubiquitin (PubMed:19328070, Ref. 37). Plays a central role in the BRCA1-A complex by specifically binding 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. Also weakly binds monoubiquitin but with much less affinity than 'Lys-63'-linked ubiquitin. May interact with monoubiquitinated histones H2A and H2B; the relevance of such results is however unclear in vivo. Does not bind Lys-48'-linked ubiquitin. May indirectly act as a transcriptional repressor by inhibiting the interaction of NR6A1 with the corepressor NCOR1.12 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator
Biological processDNA damage, DNA repair, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5689901 Metalloprotease DUBs
R-HSA-5693565 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
R-HSA-5693571 Nonhomologous End-Joining (NHEJ)
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-69473 G2/M DNA damage checkpoint

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q96RL1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
BRCA1-A complex subunit RAP80
Alternative name(s):
Receptor-associated protein 80
Retinoid X receptor-interacting protein 110
Ubiquitin interaction motif-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UIMC1
Synonyms:RAP80, RXRIP110
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30298 UIMC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609433 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96RL1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi9K → A: Does not affect symoylation; when associated with A-19; A-31; A-52 and A-61. 1 Publication1
Mutagenesisi19K → A: Does not affect symoylation; when associated with A-9; A-31; A-52 and A-61. 1 Publication1
Mutagenesisi31K → A: Does not affect symoylation; when associated with A-9; A-19; A-52 and A-61. 1 Publication1
Mutagenesisi52K → A: Does not affect symoylation; when associated with A-9; A-19; A-31 and A-61. 1 Publication1
Mutagenesisi61K → A: Does not affect symoylation; when associated with A-9; A-19; A-31 and A-52. 1 Publication1
Mutagenesisi81Missing : Strongly reduces ubiquitin binding via UIM 1. 1 Publication1
Mutagenesisi88A → G or S: Impairs localization to DNA damages sites; when associated with A-92; S-113 and A-117. 3 Publications1
Mutagenesisi92S → A: Impairs localization to DNA damages sites; when associated with S-88; S-113 and A-117. 2 Publications1
Mutagenesisi97 – 103REVNSQE → AA: Impairs the selectivity for 'K-63'-linked ubiquitin. 1 Publication7
Mutagenesisi97 – 103REVNSQE → AAAAAAA: Increases the selectivity for 'K-63'-linked ubiquitin. 1 Publication7
Mutagenesisi97 – 103REVNSQE → AAAAAAAAA: Impairs the selectivity for 'K-63'-linked ubiquitin. 1 Publication7
Mutagenesisi101S → A or E: Slightly impairs the selectivity for 'K-63'-linked ubiquitin. 1 Publication1
Mutagenesisi113A → G or S: Impairs ubiquitin-binding and localization to DNA damages sites; when associated with S-88; A-92 and A-117. 3 Publications1
Mutagenesisi117S → A: Impairs ubiquitin-binding and localization to DNA damages sites; when associated with S-88; A-92 and S-113. 2 Publications1
Mutagenesisi205S → G: Abolishes phosphorylation at this position. 1 Publication1
Mutagenesisi508C → A: Abolishes interaction with histone monoubiquitinated H2B without affecting the interaction with H2A. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
51720

Open Targets

More...
OpenTargetsi
ENSG00000087206

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162408624

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UIMC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
60390957

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000975471 – 719BRCA1-A complex subunit RAP80Add BLAST719

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei29PhosphoserineCombined sources1
Cross-linki31Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei44PhosphoserineCombined sources1
Modified residuei46PhosphoserineCombined sources1
Cross-linki75Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki90Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei101PhosphoserineCombined sources2 Publications1
Modified residuei140PhosphoserineCombined sources1 Publication1
Cross-linki188Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei205Phosphoserine2 Publications1
Cross-linki245Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei379PhosphoserineBy similarity1
Cross-linki382Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki387Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei402Phosphoserine2 Publications1
Modified residuei419Phosphoserine1 Publication1
Cross-linki428Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei466PhosphoserineCombined sources1
Cross-linki544Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki559Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki562Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki587Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki607Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei627PhosphoserineCombined sources1
Cross-linki635Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki642Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei653PhosphoserineCombined sources1
Modified residuei677PhosphoserineCombined sources1
Cross-linki696Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki697Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated.1 Publication
Phosphorylated upon DNA damage by ATM or ATR.5 Publications

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96RL1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96RL1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96RL1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96RL1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96RL1

PeptideAtlas

More...
PeptideAtlasi
Q96RL1

PRoteomics IDEntifications database

More...
PRIDEi
Q96RL1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77977 [Q96RL1-1]
77978 [Q96RL1-2]
77979 [Q96RL1-3]
77980 [Q96RL1-4]
77981 [Q96RL1-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96RL1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96RL1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testis, ovary, thymus and heart. Expressed in germ cells of the testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000087206 Expressed in 209 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96RL1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96RL1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA037503
HPA037504

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TSP57 (By similarity).

Component of the ARISC complex, at least composed of UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1 (PubMed:24075985).

Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, ABRAXAS1, BRCC3/BRCC36, BABAM2 and BABAM1/NBA1. In the BRCA1-A complex, interacts directly with ABRAXAS1.

Interacts with ESR1, NR6A1 and UBE2I.

By similarity11 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119697, 81 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q96RL1

Database of interacting proteins

More...
DIPi
DIP-29936N

Protein interaction database and analysis system

More...
IntActi
Q96RL1, 54 interactors

Molecular INTeraction database

More...
MINTi
Q96RL1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000366434

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1719
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96RL1

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q96RL1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini80 – 99UIM 1PROSITE-ProRule annotationAdd BLAST20
Domaini105 – 124UIM 2PROSITE-ProRule annotationAdd BLAST20

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 101Necessary for transcriptional repressionAdd BLAST101
Regioni97 – 103UIM-linker7
Regioni100 – 200Necessary for interaction with NR6A1 N-terminusAdd BLAST101
Regioni270 – 400AIRAdd BLAST131
Regioni400 – 500Necessary for interaction with NR6A1 C-terminusAdd BLAST101
Regioni505 – 582Zinc-finger-like regionAdd BLAST78

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi60 – 78LR motifAdd BLAST19

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi81 – 108Glu-richAdd BLAST28

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The tandem UIM domains form a continuous 60 Angstrom-long alpha-helix and mediate binding to 'Lys-63'-linked ubiquitins. UIM1 and UIM2 bind to the proximal and distal ubiquitin moieties and recognize an 'Ile-44'-centered hydrophobic patch. Since UIMs don't interact with the 'Lys-63' isopeptide bond the UIM-linker region between the 2 UIM domains determines the selectivity for 'Lys-63'-linkage, and its length is very important for specificity.By similarity3 Publications
The Abraxas-interacting region (AIR) mediates the interaction with ABRAXAS1.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the RAP80 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGE5 Eukaryota
ENOG4111MI8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007635

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96RL1

KEGG Orthology (KO)

More...
KOi
K20775

Identification of Orthologs from Complete Genome Data

More...
OMAi
CDQGFPP

Database of Orthologous Groups

More...
OrthoDBi
554207at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96RL1

TreeFam database of animal gene trees

More...
TreeFami
TF336575

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038868 RAP80
IPR040714 RAP80_UIM
IPR003903 UIM_dom

The PANTHER Classification System

More...
PANTHERi
PTHR15932 PTHR15932, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF18282 RAP80_UIM, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00726 UIM, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50330 UIM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96RL1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRRKKKVKE VSESRNLEKK DVETTSSVSV KRKRRLEDAF IVISDSDGEE
60 70 80 90 100
PKEENGLQKT KTKQSNRAKC LAKRKIAQMT EEEQFALALK MSEQEAREVN
110 120 130 140 150
SQEEEEEELL RKAIAESLNS CRPSDASATR SRPLATGPSS QSHQEKTTDS
160 170 180 190 200
GLTEGIWQLV PPSLFKGSHI SQGNEAEERE EPWDHTEKTE EEPVSGSSGS
210 220 230 240 250
WDQSSQPVFE NVNVKSFDRC TGHSAEHTQC GKPQESTGRG SAFLKAVQGS
260 270 280 290 300
GDTSRHCLPT LADAKGLQDT GGTVNYFWGI PFCPDGVDPN QYTKVILCQL
310 320 330 340 350
EVYQKSLKMA QRQLLNKKGF GEPVLPRPPS LIQNECGQGE QASEKNECIS
360 370 380 390 400
EDMGDEDKEE RQESRASDWH SKTKDFQESS IKSLKEKLLL EEEPTTSHGQ
410 420 430 440 450
SSQGIVEETS EEGNSVPASQ SVAALTSKRS LVLMPESSAE EITVCPETQL
460 470 480 490 500
SSSETFDLER EVSPGSRDIL DGVRIIMADK EVGNKEDAEK EVAISTFSSS
510 520 530 540 550
NQVSCPLCDQ CFPPTKIERH AMYCNGLMEE DTVLTRRQKE AKTKSDSGTA
560 570 580 590 600
AQTSLDIDKN EKCYLCKSLV PFREYQCHVD SCLQLAKADQ GDGPEGSGRA
610 620 630 640 650
CSTVEGKWQQ RLKNPKEKGH SEGRLLSFLE QSEHKTSDAD IKSSETGAFR
660 670 680 690 700
VPSPGMEEAG CSREMQSSFT RRDLNESPVK SFVSISEATD CLVDFKKQVT
710
VQPGSRTRTK AGRGRRRKF
Length:719
Mass (Da):79,727
Last modified:March 1, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i56B7699E42395861
GO
Isoform 2 (identifier: Q96RL1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     234-399: Missing.

Show »
Length:553
Mass (Da):61,325
Checksum:i61E2037D20BB900B
GO
Isoform 3 (identifier: Q96RL1-3) [UniParc]FASTAAdd to basket
Also known as: XHRIP110

The sequence of this isoform differs from the canonical sequence as follows:
     1-78: Missing.

Show »
Length:641
Mass (Da):70,744
Checksum:i62A782DFDA0E30AD
GO
Isoform 4 (identifier: Q96RL1-4) [UniParc]FASTAAdd to basket
Also known as: X2HRIP110

The sequence of this isoform differs from the canonical sequence as follows:
     1-370: Missing.
     371-400: SKTKDFQESSIKSLKEKLLLEEEPTTSHGQ → MLPLPDLDLWPLDRLPSPIKRKPQTLGSLK

Show »
Length:349
Mass (Da):38,477
Checksum:iF6A39455A3642247
GO
Isoform 5 (identifier: Q96RL1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     120-152: SCRPSDASATRSRPLATGPSSQSHQEKTTDSGL → VNMPCCKSLWRLISYIFDFCGVVVALGTSCSHL
     153-719: Missing.

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):17,412
Checksum:iC0CB4F0EBE4ADA49
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RC40D6RC40_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
157Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RCQ3D6RCQ3_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDZ5D6RDZ5_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9M3D6R9M3_HUMAN
BRCA1-A complex subunit RAP80
UIMC1
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH06078 differs from that shown. Reason: Erroneous termination at position 386. Translated as Glu.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti187E → K in AAH06078 (PubMed:15489334).Curated1
Sequence conflicti192E → G in BAG51153 (PubMed:14702039).Curated1
Sequence conflicti247V → C in AAG59851 (Ref. 3) Curated1
Sequence conflicti347E → G in AAK61871 (PubMed:12080054).Curated1
Sequence conflicti518E → G in AAK61871 (PubMed:12080054).Curated1
Sequence conflicti634H → R in AAG59855 (Ref. 3) Curated1
Sequence conflicti638D → N in BAG51153 (PubMed:14702039).Curated1
Sequence conflicti694D → V in AAG59855 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05146915R → W Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs13167812Ensembl.1
Natural variantiVAR_055328353M → T Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs143282828Ensembl.1
Natural variantiVAR_051470435P → L Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs3733876Ensembl.1
Natural variantiVAR_051471511C → R Common polymorphism not associated with susceptibility to breast cancer. 1 PublicationCorresponds to variant dbSNP:rs13360277Ensembl.1
Natural variantiVAR_051472596G → E. Corresponds to variant dbSNP:rs10475633Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0129331 – 370Missing in isoform 4. 2 PublicationsAdd BLAST370
Alternative sequenceiVSP_0129321 – 78Missing in isoform 3. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_037264120 – 152SCRPS…TDSGL → VNMPCCKSLWRLISYIFDFC GVVVALGTSCSHL in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_037265153 – 719Missing in isoform 5. 1 PublicationAdd BLAST567
Alternative sequenceiVSP_012935234 – 399Missing in isoform 2. 1 PublicationAdd BLAST166
Alternative sequenceiVSP_012934371 – 400SKTKD…TSHGQ → MLPLPDLDLWPLDRLPSPIK RKPQTLGSLK in isoform 4. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF349313 mRNA Translation: AAK61871.1
AF113538 mRNA Translation: AAF14875.1
AF284749 mRNA Translation: AAG59851.1
AF284753 mRNA Translation: AAG59855.1
AK023044 mRNA Translation: BAG51153.1
AK304794 mRNA Translation: BAG65544.1
BX537376 mRNA Translation: CAD97618.1
AC027318 Genomic DNA No translation available.
BC006078 mRNA Translation: AAH06078.1 Different termination.
BC032561 mRNA Translation: AAH32561.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4408.1 [Q96RL1-1]
CCDS83050.1 [Q96RL1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001186226.1, NM_001199297.2 [Q96RL1-1]
NP_001186227.1, NM_001199298.1 [Q96RL1-1]
NP_001304890.1, NM_001317961.1 [Q96RL1-2]
NP_057374.3, NM_016290.4 [Q96RL1-1]
XP_005265987.1, XM_005265930.2 [Q96RL1-1]
XP_005265993.1, XM_005265936.2 [Q96RL1-4]
XP_006714934.1, XM_006714871.2 [Q96RL1-1]
XP_016865063.1, XM_017009574.1 [Q96RL1-3]
XP_016865067.1, XM_017009578.1 [Q96RL1-4]
XP_016865068.1, XM_017009579.1 [Q96RL1-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000377227; ENSP00000366434; ENSG00000087206 [Q96RL1-1]
ENST00000506128; ENSP00000427480; ENSG00000087206 [Q96RL1-2]
ENST00000510698; ENSP00000423717; ENSG00000087206 [Q96RL1-4]
ENST00000511320; ENSP00000421926; ENSG00000087206 [Q96RL1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51720

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51720

UCSC genome browser

More...
UCSCi
uc063kam.1 human [Q96RL1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF349313 mRNA Translation: AAK61871.1
AF113538 mRNA Translation: AAF14875.1
AF284749 mRNA Translation: AAG59851.1
AF284753 mRNA Translation: AAG59855.1
AK023044 mRNA Translation: BAG51153.1
AK304794 mRNA Translation: BAG65544.1
BX537376 mRNA Translation: CAD97618.1
AC027318 Genomic DNA No translation available.
BC006078 mRNA Translation: AAH06078.1 Different termination.
BC032561 mRNA Translation: AAH32561.1
CCDSiCCDS4408.1 [Q96RL1-1]
CCDS83050.1 [Q96RL1-2]
RefSeqiNP_001186226.1, NM_001199297.2 [Q96RL1-1]
NP_001186227.1, NM_001199298.1 [Q96RL1-1]
NP_001304890.1, NM_001317961.1 [Q96RL1-2]
NP_057374.3, NM_016290.4 [Q96RL1-1]
XP_005265987.1, XM_005265930.2 [Q96RL1-1]
XP_005265993.1, XM_005265936.2 [Q96RL1-4]
XP_006714934.1, XM_006714871.2 [Q96RL1-1]
XP_016865063.1, XM_017009574.1 [Q96RL1-3]
XP_016865067.1, XM_017009578.1 [Q96RL1-4]
XP_016865068.1, XM_017009579.1 [Q96RL1-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MKFNMR-A74-131[»]
2MKGNMR-A74-131[»]
2N9ENMR-A37-49[»]
2RR9NMR-C79-124[»]
SMRiQ96RL1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119697, 81 interactors
CORUMiQ96RL1
DIPiDIP-29936N
IntActiQ96RL1, 54 interactors
MINTiQ96RL1
STRINGi9606.ENSP00000366434

PTM databases

iPTMnetiQ96RL1
PhosphoSitePlusiQ96RL1

Polymorphism and mutation databases

BioMutaiUIMC1
DMDMi60390957

Proteomic databases

EPDiQ96RL1
jPOSTiQ96RL1
MassIVEiQ96RL1
MaxQBiQ96RL1
PaxDbiQ96RL1
PeptideAtlasiQ96RL1
PRIDEiQ96RL1
ProteomicsDBi77977 [Q96RL1-1]
77978 [Q96RL1-2]
77979 [Q96RL1-3]
77980 [Q96RL1-4]
77981 [Q96RL1-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51720
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377227; ENSP00000366434; ENSG00000087206 [Q96RL1-1]
ENST00000506128; ENSP00000427480; ENSG00000087206 [Q96RL1-2]
ENST00000510698; ENSP00000423717; ENSG00000087206 [Q96RL1-4]
ENST00000511320; ENSP00000421926; ENSG00000087206 [Q96RL1-1]
GeneIDi51720
KEGGihsa:51720
UCSCiuc063kam.1 human [Q96RL1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51720
DisGeNETi51720

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UIMC1
HGNCiHGNC:30298 UIMC1
HPAiHPA037503
HPA037504
MIMi609433 gene
neXtProtiNX_Q96RL1
OpenTargetsiENSG00000087206
PharmGKBiPA162408624

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGE5 Eukaryota
ENOG4111MI8 LUCA
GeneTreeiENSGT00390000007635
InParanoidiQ96RL1
KOiK20775
OMAiCDQGFPP
OrthoDBi554207at2759
PhylomeDBiQ96RL1
TreeFamiTF336575

Enzyme and pathway databases

ReactomeiR-HSA-5689901 Metalloprotease DUBs
R-HSA-5693565 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks
R-HSA-5693571 Nonhomologous End-Joining (NHEJ)
R-HSA-5693607 Processing of DNA double-strand break ends
R-HSA-69473 G2/M DNA damage checkpoint
SIGNORiQ96RL1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UIMC1 human
EvolutionaryTraceiQ96RL1

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UIMC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51720

Pharos

More...
Pharosi
Q96RL1

Protein Ontology

More...
PROi
PR:Q96RL1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000087206 Expressed in 209 organ(s), highest expression level in testis
ExpressionAtlasiQ96RL1 baseline and differential
GenevisibleiQ96RL1 HS

Family and domain databases

InterProiView protein in InterPro
IPR038868 RAP80
IPR040714 RAP80_UIM
IPR003903 UIM_dom
PANTHERiPTHR15932 PTHR15932, 1 hit
PfamiView protein in Pfam
PF18282 RAP80_UIM, 1 hit
SMARTiView protein in SMART
SM00726 UIM, 2 hits
PROSITEiView protein in PROSITE
PS50330 UIM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUIMC1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96RL1
Secondary accession number(s): A8MSA1
, B3KMZ1, B4E3N2, Q5XKQ1, Q7Z3W7, Q8N5B9, Q9BZR1, Q9BZR5, Q9UHX7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: March 1, 2005
Last modified: September 18, 2019
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again