Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96RD9 (FCRL5_HUMAN)

Entry version 164 (22 Apr 2020)
Sequence version 3 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Fc receptor-like protein 5

Gene

FCRL5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells.1 Publication

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Fc receptor-like protein 5
Short name:
FcR-like protein 5
Short name:
FcRL5
Alternative name(s):
BXMAS1
Fc receptor homolog 5
Short name:
FcRH5
Immune receptor translocation-associated protein 2
CD_antigen: CD307e
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FCRL5
Synonyms:FCRH5, IRTA2
ORF Names:UNQ503/PRO820
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:18508 FCRL5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605877 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96RD9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini16 – 851ExtracellularSequence analysisAdd BLAST836
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei852 – 872HelicalSequence analysisAdd BLAST21
Topological domaini873 – 977CytoplasmicSequence analysisAdd BLAST105

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup(1)(q21q32).1 Publication

Organism-specific databases

DisGeNET

More...DisGeNETi		83416

Open Targets

More...OpenTargetsi		ENSG00000143297

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671769

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96RD9 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FCRL5

Domain mapping of disease mutations (DMDM)

More...DMDMi		296439341

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 15Sequence analysisAdd BLAST15
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000022562216 – 977Fc receptor-like protein 5Add BLAST962

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi44 ↔ 85PROSITE-ProRule annotation
Disulfide bondi211 ↔ 260PROSITE-ProRule annotation
Disulfide bondi308 ↔ 355PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi383N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi401 ↔ 448PROSITE-ProRule annotation
Disulfide bondi494 ↔ 541PROSITE-ProRule annotation
Disulfide bondi587 ↔ 634PROSITE-ProRule annotation
Disulfide bondi680 ↔ 727PROSITE-ProRule annotation
Disulfide bondi773 ↔ 819PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96RD9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96RD9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96RD9

PeptideAtlas

More...PeptideAtlasi		Q96RD9

PRoteomics IDEntifications database

More...PRIDEi		Q96RD9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		77948 [Q96RD9-1]
77949 [Q96RD9-2]
77950 [Q96RD9-3]
77951 [Q96RD9-4]
77952 [Q96RD9-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96RD9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96RD9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, isoform 4 and isoform 5 are detected in lymph node, spleen, bone marrow, and small intestine with preponderance of isoform 3. Expressed in mature and memory B-cells and down-regulated in germinal center cells (at protein level).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000143297 Expressed in spleen and 104 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96RD9 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000143297 Tissue enhanced (blood, lymphoid tissue, salivary gland)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		123640, 9 interactors

Protein interaction database and analysis system

More...IntActi		Q96RD9, 9 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000354691

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96RD9 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini23 – 101Ig-like C2-type 1Add BLAST79
Domaini188 – 271Ig-like C2-type 2Add BLAST84
Domaini287 – 374Ig-like C2-type 3Add BLAST88
Domaini380 – 463Ig-like C2-type 4Add BLAST84
Domaini473 – 556Ig-like C2-type 5Add BLAST84
Domaini566 – 651Ig-like C2-type 6Add BLAST86
Domaini659 – 744Ig-like C2-type 7Add BLAST86
Domaini752 – 834Ig-like C2-type 8Add BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi897 – 902ITIM motif 16
Motifi910 – 915ITIM motif 26
Motifi922 – 927ITIM motif 36
Motifi952 – 957ITIM motif 46

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM).By similarity

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IH5T Eukaryota
ENOG410YF57 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00960000186653

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_325948_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96RD9

KEGG Orthology (KO)

More...KOi		K06727

Identification of Orthologs from Complete Genome Data

More...OMAi		SYACEAD

Database of Orthologous Groups

More...OrthoDBi		53940at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96RD9

TreeFam database of animal gene trees

More...TreeFami		TF351107

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 9 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2

Pfam protein domain database

More...Pfami		View protein in Pfam
PF13895 Ig_2, 7 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409 IG, 9 hits
SM00408 IGc2, 8 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726 SSF48726, 9 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835 IG_LIKE, 8 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96RD9-1) [UniParc]FASTAAdd to basket
Also known as: IRTA2c

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLLWVILLVL APVSGQFART PRPIIFLQPP WTTVFQGERV TLTCKGFRFY 
        60         70         80         90        100
SPQKTKWYHR YLGKEILRET PDNILEVQES GEYRCQAQGS PLSSPVHLDF 
       110        120        130        140        150
SSASLILQAP LSVFEGDSVV LRCRAKAEVT LNNTIYKNDN VLAFLNKRTD 
       160        170        180        190        200
FHIPHACLKD NGAYRCTGYK ESCCPVSSNT VKIQVQEPFT RPVLRASSFQ 
       210        220        230        240        250
PISGNPVTLT CETQLSLERS DVPLRFRFFR DDQTLGLGWS LSPNFQITAM 
       260        270        280        290        300
WSKDSGFYWC KAATMPYSVI SDSPRSWIQV QIPASHPVLT LSPEKALNFE 
       310        320        330        340        350
GTKVTLHCET QEDSLRTLYR FYHEGVPLRH KSVRCERGAS ISFSLTTENS 
       360        370        380        390        400
GNYYCTADNG LGAKPSKAVS LSVTVPVSHP VLNLSSPEDL IFEGAKVTLH 
       410        420        430        440        450
CEAQRGSLPI LYQFHHEGAA LERRSANSAG GVAISFSLTA EHSGNYYCTA 
       460        470        480        490        500
DNGFGPQRSK AVSLSVTVPV SHPVLTLSSA EALTFEGATV TLHCEVQRGS 
       510        520        530        540        550
PQILYQFYHE DMPLWSSSTP SVGRVSFSFS LTEGHSGNYY CTADNGFGPQ 
       560        570        580        590        600
RSEVVSLFVT VPVSRPILTL RVPRAQAVVG DLLELHCEAP RGSPPILYWF 
       610        620        630        640        650
YHEDVTLGSS SAPSGGEASF NLSLTAEHSG NYSCEANNGL VAQHSDTISL 
       660        670        680        690        700
SVIVPVSRPI LTFRAPRAQA VVGDLLELHC EALRGSSPIL YWFYHEDVTL 
       710        720        730        740        750
GKISAPSGGG ASFNLSLTTE HSGIYSCEAD NGLEAQRSEM VTLKVAVPVS 
       760        770        780        790        800
RPVLTLRAPG THAAVGDLLE LHCEALRGSP LILYRFFHED VTLGNRSSPS 
       810        820        830        840        850
GGASLNLSLT AEHSGNYSCE ADNGLGAQRS ETVTLYITGL TANRSGPFAT 
       860        870        880        890        900
GVAGGLLSIA GLAAGALLLY CWLSRKAGRK PASDPARSPS DSDSQEPTYH 
       910        920        930        940        950
NVPAWEELQP VYTNANPRGE NVVYSEVRII QEKKKHAVAS DPRHLRNKGS 
       960        970 
PIIYSEVKVA STPVSGSLFL ASSAPHR
Length:977
Mass (Da):106,437
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9545DA1B6A164FDD
GO
Isoform 2 (identifier: Q96RD9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-124: ASLILQAPLSVFEGDSVVLRCR → EMGFPHAAQANVELLGSSDLLT
     125-977: Missing.

Show »
Length:124
Mass (Da):14,080
Checksum:iD7915849A385455D
GO
Isoform 3 (identifier: Q96RD9-3) [UniParc]FASTAAdd to basket
Also known as: IRTA2a

The sequence of this isoform differs from the canonical sequence as follows:
     747-759: VPVSRPVLTLRAP → GEWALPTSSTSEN
     760-977: Missing.

Show »
Length:759
Mass (Da):83,293
Checksum:i11903D6E89081BC9
GO
Isoform 4 (identifier: Q96RD9-4) [UniParc]FASTAAdd to basket
Also known as: IRTA2b

The sequence of this isoform differs from the canonical sequence as follows:
     561-592: VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG → GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP
     593-977: Missing.

Show »
Length:592
Mass (Da):65,617
Checksum:iD99E9511BC528621
GO
Isoform 5 (identifier: Q96RD9-5) [UniParc]FASTAAdd to basket
Also known as: IRTA2d

The sequence of this isoform differs from the canonical sequence as follows:
     152-152: H → Q
     153-977: Missing.

Show »
Length:152
Mass (Da):17,377
Checksum:i0437E9CBE8D3792C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti733L → P in AAK50059 (PubMed:11453668).Curated1
Sequence conflicti890S → P in AAK50059 (PubMed:11453668).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_025447267Y → H4 PublicationsCorresponds to variant dbSNP:rs6679793Ensembl.1
Natural variantiVAR_025448269V → I2 PublicationsCorresponds to variant dbSNP:rs12036228Ensembl.1
Natural variantiVAR_025449418G → D5 PublicationsCorresponds to variant dbSNP:rs2012199Ensembl.1
Natural variantiVAR_056044427N → K. Corresponds to variant dbSNP:rs16838748Ensembl.1
Natural variantiVAR_056045457Q → R. Corresponds to variant dbSNP:rs34868810Ensembl.1
Natural variantiVAR_025450466V → I5 PublicationsCorresponds to variant dbSNP:rs6427384Ensembl.1
Natural variantiVAR_035514687S → C in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_017379103 – 124ASLIL…VLRCR → EMGFPHAAQANVELLGSSDL LT in isoform 2. 2 PublicationsAdd BLAST22
Alternative sequenceiVSP_017380125 – 977Missing in isoform 2. 2 PublicationsAdd BLAST853
Alternative sequenceiVSP_017381152H → Q in isoform 5. 1 Publication1
Alternative sequenceiVSP_017382153 – 977Missing in isoform 5. 1 PublicationAdd BLAST825
Alternative sequenceiVSP_017383561 – 592VPVSR…EAPRG → GKCWVLASHPPLAEFSLTHS FKNLFALSSFLP in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_017384593 – 977Missing in isoform 4. 1 PublicationAdd BLAST385
Alternative sequenceiVSP_017385747 – 759VPVSR…TLRAP → GEWALPTSSTSEN in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_017386760 – 977Missing in isoform 3. 1 PublicationAdd BLAST218

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF369794 mRNA Translation: AAK50059.2
AF343662 mRNA Translation: AAK31325.1
AF343663 mRNA Translation: AAK31326.1
AF343664 mRNA Translation: AAK31327.1
AF343665 mRNA Translation: AAK31328.1
AF397453 mRNA Translation: AAK93971.1
AY358085 mRNA Translation: AAQ88452.1
AL834187 mRNA Translation: CAH56486.1
EF064730 Genomic DNA Translation: ABK41913.1
AL135929 Genomic DNA No translation available.
AL353899 Genomic DNA No translation available.
BC101066 mRNA Translation: AAI01067.1
BC101067 mRNA Translation: AAI01068.1
BC101069 mRNA Translation: AAI01070.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1165.1 [Q96RD9-1]

NCBI Reference Sequences

More...RefSeqi		NP_001182317.1, NM_001195388.1
NP_112571.2, NM_031281.2 [Q96RD9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000361835; ENSP00000354691; ENSG00000143297 [Q96RD9-1]
ENST00000368189; ENSP00000357172; ENSG00000143297 [Q96RD9-4]
ENST00000368190; ENSP00000357173; ENSG00000143297 [Q96RD9-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		83416

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:83416

UCSC genome browser

More...UCSCi		uc001fqu.3 human [Q96RD9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF369794 mRNA Translation: AAK50059.2
AF343662 mRNA Translation: AAK31325.1
AF343663 mRNA Translation: AAK31326.1
AF343664 mRNA Translation: AAK31327.1
AF343665 mRNA Translation: AAK31328.1
AF397453 mRNA Translation: AAK93971.1
AY358085 mRNA Translation: AAQ88452.1
AL834187 mRNA Translation: CAH56486.1
EF064730 Genomic DNA Translation: ABK41913.1
AL135929 Genomic DNA No translation available.
AL353899 Genomic DNA No translation available.
BC101066 mRNA Translation: AAI01067.1
BC101067 mRNA Translation: AAI01068.1
BC101069 mRNA Translation: AAI01070.1
CCDSiCCDS1165.1 [Q96RD9-1]
RefSeqiNP_001182317.1, NM_001195388.1
NP_112571.2, NM_031281.2 [Q96RD9-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi123640, 9 interactors
IntActiQ96RD9, 9 interactors
STRINGi9606.ENSP00000354691

PTM databases

iPTMnetiQ96RD9
PhosphoSitePlusiQ96RD9

Polymorphism and mutation databases

BioMutaiFCRL5
DMDMi296439341

Proteomic databases

jPOSTiQ96RD9
MassIVEiQ96RD9
PaxDbiQ96RD9
PeptideAtlasiQ96RD9
PRIDEiQ96RD9
ProteomicsDBi77948 [Q96RD9-1]
77949 [Q96RD9-2]
77950 [Q96RD9-3]
77951 [Q96RD9-4]
77952 [Q96RD9-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		47044 217 antibodies

Genome annotation databases

EnsembliENST00000361835; ENSP00000354691; ENSG00000143297 [Q96RD9-1]
ENST00000368189; ENSP00000357172; ENSG00000143297 [Q96RD9-4]
ENST00000368190; ENSP00000357173; ENSG00000143297 [Q96RD9-3]
GeneIDi83416
KEGGihsa:83416
UCSCiuc001fqu.3 human [Q96RD9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		83416
DisGeNETi83416

GeneCards: human genes, protein and diseases

More...GeneCardsi		FCRL5
HGNCiHGNC:18508 FCRL5
HPAiENSG00000143297 Tissue enhanced (blood, lymphoid tissue, salivary gland)
MIMi605877 gene
neXtProtiNX_Q96RD9
OpenTargetsiENSG00000143297
PharmGKBiPA142671769

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IH5T Eukaryota
ENOG410YF57 LUCA
GeneTreeiENSGT00960000186653
HOGENOMiCLU_325948_0_0_1
InParanoidiQ96RD9
KOiK06727
OMAiSYACEAD
OrthoDBi53940at2759
PhylomeDBiQ96RD9
TreeFamiTF351107

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FCRL5 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		FCRL5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		83416
PharosiQ96RD9 Tbio

Protein Ontology

More...PROi		PR:Q96RD9
RNActiQ96RD9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000143297 Expressed in spleen and 104 other tissues
GenevisibleiQ96RD9 HS

Family and domain databases

Gene3Di2.60.40.10, 9 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF13895 Ig_2, 7 hits
SMARTiView protein in SMART
SM00409 IG, 9 hits
SM00408 IGc2, 8 hits
SUPFAMiSSF48726 SSF48726, 9 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 8 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFCRL5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96RD9
Secondary accession number(s): A0N0M2
, B7WNT9, B7WP94, Q495Q2, Q495Q4, Q5VYK9, Q6UY46
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: May 18, 2010
Last modified: April 22, 2020
This is version 164 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again