Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (07 Oct 2020)
Sequence version 2 (18 May 2010)
Previous versions | rss
Add a publicationFeedback
Protein

Pannexin-2

Gene

PANX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Structural component of the gap junctions and the hemichannels.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel
Biological processIon transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q96RD6

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-112303, Electric Transmission Across Gap Junctions

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.25.2.2, the gap junction-forming innexin (innexin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pannexin-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PANX2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000073150.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8600, PANX2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608421, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96RD6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini11 – 47CytoplasmicSequence analysisAdd BLAST37
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei48 – 70HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini71 – 123ExtracellularSequence analysisAdd BLAST53
Transmembranei124 – 146HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini147 – 226CytoplasmicSequence analysisAdd BLAST80
Transmembranei227 – 249HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini250 – 292ExtracellularSequence analysisAdd BLAST43
Transmembranei293 – 315HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini316 – 643CytoplasmicSequence analysisAdd BLAST328

Keywords - Cellular componenti

Cell junction, Cell membrane, Gap junction, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56666

Open Targets

More...
OpenTargetsi
ENSG00000073150

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA32930

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96RD6, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PANX2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439257

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002084881 – 677Pannexin-2Add BLAST677

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei593PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96RD6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96RD6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96RD6

PeptideAtlas

More...
PeptideAtlasi
Q96RD6

PRoteomics IDEntifications database

More...
PRIDEi
Q96RD6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
77943 [Q96RD6-3]
77944 [Q96RD6-1]
77945 [Q96RD6-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q96RD6, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96RD6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96RD6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000073150, Expressed in prefrontal cortex and 134 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96RD6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96RD6, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000073150, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms PANX1/PANX2-heteromeric intercellular channels on coexpression in paired Xenopus oocytes. Does not form homomeric channels (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
121176, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q96RD6, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000379183

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96RD6, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the pannexin family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QT63, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153972

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_027715_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96RD6

KEGG Orthology (KO)

More...
KOi
K20857

Identification of Orthologs from Complete Genome Data

More...
OMAi
VLLCAMN

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96RD6

TreeFam database of animal gene trees

More...
TreeFami
TF333142

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000990, Innexin
IPR039099, Pannexin

The PANTHER Classification System

More...
PANTHERi
PTHR15759, PTHR15759, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00876, Innexin, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51013, PANNEXIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 3 (identifier: Q96RD6-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHHLLEQSAD MATALLAGEK LRELILPGAQ DDKAGALAAL LLQLKLELPF
60 70 80 90 100
DRVVTIGTVL VPILLVTLVF TKNFAEEPIY CYTPHNFTRD QALYARGYCW
110 120 130 140 150
TELRDALPGV DASLWPSLFE HKFLPYALLA FAAIMYVPAL GWEFLASTRL
160 170 180 190 200
TSELNFLLQE IDNCYHRAAE GRAPKIEKQI QSKGPGITER EKREIIENAE
210 220 230 240 250
KEKSPEQNLF EKYLERRGRS NFLAKLYLAR HVLILLLSAV PISYLCTYYA
260 270 280 290 300
TQKQNEFTCA LGASPDGAAG AGPAVRVSCK LPSVQLQRII AGVDIVLLCV
310 320 330 340 350
MNLIILVNLI HLFIFRKSNF IFDKLHKVGI KTRRQWRRSQ FCDINILAMF
360 370 380 390 400
CNENRDHIKS LNRLDFITNE SDLMYDNVVR QLLAALAQSN HDATPTVRDS
410 420 430 440 450
GVQTVDPSAN PAEPDGAAEP PVVKRPRKKM KWIPTSNPLP QPFKEPLAIM
460 470 480 490 500
RVENSKAEKP KPARRKTATD TLIAPLLDRS AHHYKGGGGD PGPGPAPAPA
510 520 530 540 550
PPPAPDKKHA RHFSLDVHPY ILGTKKAKAE AVPAALPASR SQEGGFLSQA
560 570 580 590 600
EDCGLGLAPA PIKDAPLPEK EIPYPTEPAR AGLPSGGPFH VRSPPAAPAV
610 620 630 640 650
APLTPASLGK AEPLTILSRN ATHPLLHINT LYEAREEEDG GPRLPQDVGD
660 670
LIAIPAPQQI LIATFDEPRT VVSTVEF
Length:677
Mass (Da):74,447
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE15C741192B1BD46
GO
Isoform 1 (identifier: Q96RD6-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     632-677: YEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF → SSSPPSTSRERS

Show »
Length:643
Mass (Da):70,641
Checksum:iBFD3E97C92D8ED86
GO
Isoform 2 (identifier: Q96RD6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     632-677: YEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF → SSSPPSTSRERS

Show »
Length:509
Mass (Da):55,733
Checksum:i1AB66CD9F2F6FAC2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W8Y4F8W8Y4_HUMAN
Pannexin-2
PANX2
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036575147S → F in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs941735789Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0390921 – 134Missing in isoform 2. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_002677632 – 677YEARE…STVEF → SSSPPSTSRERS in isoform 1 and isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF398510 mRNA Translation: AAK91715.1
AF398511 mRNA Translation: AAK91716.1
AK299910 mRNA Translation: BAH13170.1
AL022328 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14085.2 [Q96RD6-3]
CCDS54544.1 [Q96RD6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001153772.1, NM_001160300.1 [Q96RD6-1]
NP_443071.2, NM_052839.3 [Q96RD6-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000159647; ENSP00000159647; ENSG00000073150 [Q96RD6-1]
ENST00000395842; ENSP00000379183; ENSG00000073150 [Q96RD6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56666

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56666

UCSC genome browser

More...
UCSCi
uc003bjn.5, human [Q96RD6-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Wikipedia

Pannexin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF398510 mRNA Translation: AAK91715.1
AF398511 mRNA Translation: AAK91716.1
AK299910 mRNA Translation: BAH13170.1
AL022328 Genomic DNA No translation available.
CCDSiCCDS14085.2 [Q96RD6-3]
CCDS54544.1 [Q96RD6-1]
RefSeqiNP_001153772.1, NM_001160300.1 [Q96RD6-1]
NP_443071.2, NM_052839.3 [Q96RD6-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi121176, 3 interactors
IntActiQ96RD6, 3 interactors
STRINGi9606.ENSP00000379183

Protein family/group databases

TCDBi1.A.25.2.2, the gap junction-forming innexin (innexin) family

PTM databases

GlyGeniQ96RD6, 1 site
iPTMnetiQ96RD6
PhosphoSitePlusiQ96RD6

Polymorphism and mutation databases

BioMutaiPANX2
DMDMi296439257

Proteomic databases

jPOSTiQ96RD6
MassIVEiQ96RD6
PaxDbiQ96RD6
PeptideAtlasiQ96RD6
PRIDEiQ96RD6
ProteomicsDBi77943 [Q96RD6-3]
77944 [Q96RD6-1]
77945 [Q96RD6-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
14165, 174 antibodies

The DNASU plasmid repository

More...
DNASUi
56666

Genome annotation databases

EnsembliENST00000159647; ENSP00000159647; ENSG00000073150 [Q96RD6-1]
ENST00000395842; ENSP00000379183; ENSG00000073150 [Q96RD6-3]
GeneIDi56666
KEGGihsa:56666
UCSCiuc003bjn.5, human [Q96RD6-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56666
DisGeNETi56666
EuPathDBiHostDB:ENSG00000073150.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PANX2
HGNCiHGNC:8600, PANX2
HPAiENSG00000073150, Tissue enhanced (brain)
MIMi608421, gene
neXtProtiNX_Q96RD6
OpenTargetsiENSG00000073150
PharmGKBiPA32930

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QT63, Eukaryota
GeneTreeiENSGT00940000153972
HOGENOMiCLU_027715_0_0_1
InParanoidiQ96RD6
KOiK20857
OMAiVLLCAMN
PhylomeDBiQ96RD6
TreeFamiTF333142

Enzyme and pathway databases

PathwayCommonsiQ96RD6
ReactomeiR-HSA-112303, Electric Transmission Across Gap Junctions

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
56666, 2 hits in 868 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PANX2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56666
PharosiQ96RD6, Tbio

Protein Ontology

More...
PROi
PR:Q96RD6
RNActiQ96RD6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000073150, Expressed in prefrontal cortex and 134 other tissues
ExpressionAtlasiQ96RD6, baseline and differential
GenevisibleiQ96RD6, HS

Family and domain databases

InterProiView protein in InterPro
IPR000990, Innexin
IPR039099, Pannexin
PANTHERiPTHR15759, PTHR15759, 1 hit
PfamiView protein in Pfam
PF00876, Innexin, 1 hit
PROSITEiView protein in PROSITE
PS51013, PANNEXIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPANX2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96RD6
Secondary accession number(s): B7Z684, Q96RD5, Q9UGX8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: May 18, 2010
Last modified: October 7, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again