Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pannexin-2

Gene

PANX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Structural component of the gap junctions and the hemichannels.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionIon channel
Biological processIon transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-112303 Electric Transmission Across Gap Junctions

Protein family/group databases

TCDBi1.A.25.2.2 the gap junction-forming innexin (innexin) family

Names & Taxonomyi

Protein namesi
Recommended name:
Pannexin-2
Gene namesi
Name:PANX2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000073150.13
HGNCiHGNC:8600 PANX2
MIMi608421 gene
neXtProtiNX_Q96RD6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini11 – 47CytoplasmicSequence analysisAdd BLAST37
Transmembranei48 – 70HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini71 – 123ExtracellularSequence analysisAdd BLAST53
Transmembranei124 – 146HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini147 – 226CytoplasmicSequence analysisAdd BLAST80
Transmembranei227 – 249HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini250 – 292ExtracellularSequence analysisAdd BLAST43
Transmembranei293 – 315HelicalPROSITE-ProRule annotationAdd BLAST23
Topological domaini316 – 643CytoplasmicSequence analysisAdd BLAST328

Keywords - Cellular componenti

Cell junction, Cell membrane, Gap junction, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi56666
OpenTargetsiENSG00000073150
PharmGKBiPA32930

Polymorphism and mutation databases

BioMutaiPANX2
DMDMi296439257

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002084881 – 677Pannexin-2Add BLAST677

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi86N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei593PhosphoserineBy similarity1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ96RD6
PeptideAtlasiQ96RD6
PRIDEiQ96RD6
ProteomicsDBi77943
77944 [Q96RD6-1]
77945 [Q96RD6-2]

PTM databases

iPTMnetiQ96RD6
PhosphoSitePlusiQ96RD6

Expressioni

Gene expression databases

BgeeiENSG00000073150 Expressed in 120 organ(s), highest expression level in prefrontal cortex
CleanExiHS_PANX2
ExpressionAtlasiQ96RD6 baseline and differential
GenevisibleiQ96RD6 HS

Organism-specific databases

HPAiHPA004624
HPA039117

Interactioni

Subunit structurei

Forms PANX1/PANX2-heteromeric intercellular channels on coexpression in paired Xenopus oocytes. Does not form homomeric channels (By similarity).By similarity

Protein-protein interaction databases

IntActiQ96RD6, 1 interactor
STRINGi9606.ENSP00000379183

Structurei

3D structure databases

ProteinModelPortaliQ96RD6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the pannexin family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGKS Eukaryota
ENOG4110P9D LUCA
GeneTreeiENSGT00390000009703
HOGENOMiHOG000082414
HOVERGENiHBG053498
InParanoidiQ96RD6
KOiK20857
OMAiKSQFCDI
OrthoDBiEOG091G086D
PhylomeDBiQ96RD6
TreeFamiTF333142

Family and domain databases

InterProiView protein in InterPro
IPR000990 Innexin
IPR039099 Pannexin
PANTHERiPTHR15759 PTHR15759, 1 hit
PfamiView protein in Pfam
PF00876 Innexin, 1 hit
PROSITEiView protein in PROSITE
PS51013 PANNEXIN, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 3 (identifier: Q96RD6-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHHLLEQSAD MATALLAGEK LRELILPGAQ DDKAGALAAL LLQLKLELPF
60 70 80 90 100
DRVVTIGTVL VPILLVTLVF TKNFAEEPIY CYTPHNFTRD QALYARGYCW
110 120 130 140 150
TELRDALPGV DASLWPSLFE HKFLPYALLA FAAIMYVPAL GWEFLASTRL
160 170 180 190 200
TSELNFLLQE IDNCYHRAAE GRAPKIEKQI QSKGPGITER EKREIIENAE
210 220 230 240 250
KEKSPEQNLF EKYLERRGRS NFLAKLYLAR HVLILLLSAV PISYLCTYYA
260 270 280 290 300
TQKQNEFTCA LGASPDGAAG AGPAVRVSCK LPSVQLQRII AGVDIVLLCV
310 320 330 340 350
MNLIILVNLI HLFIFRKSNF IFDKLHKVGI KTRRQWRRSQ FCDINILAMF
360 370 380 390 400
CNENRDHIKS LNRLDFITNE SDLMYDNVVR QLLAALAQSN HDATPTVRDS
410 420 430 440 450
GVQTVDPSAN PAEPDGAAEP PVVKRPRKKM KWIPTSNPLP QPFKEPLAIM
460 470 480 490 500
RVENSKAEKP KPARRKTATD TLIAPLLDRS AHHYKGGGGD PGPGPAPAPA
510 520 530 540 550
PPPAPDKKHA RHFSLDVHPY ILGTKKAKAE AVPAALPASR SQEGGFLSQA
560 570 580 590 600
EDCGLGLAPA PIKDAPLPEK EIPYPTEPAR AGLPSGGPFH VRSPPAAPAV
610 620 630 640 650
APLTPASLGK AEPLTILSRN ATHPLLHINT LYEAREEEDG GPRLPQDVGD
660 670
LIAIPAPQQI LIATFDEPRT VVSTVEF
Length:677
Mass (Da):74,447
Last modified:May 18, 2010 - v2
Checksum:iE15C741192B1BD46
GO
Isoform 1 (identifier: Q96RD6-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     632-677: YEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF → SSSPPSTSRERS

Show »
Length:643
Mass (Da):70,641
Checksum:iBFD3E97C92D8ED86
GO
Isoform 2 (identifier: Q96RD6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     632-677: YEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF → SSSPPSTSRERS

Show »
Length:509
Mass (Da):55,733
Checksum:i1AB66CD9F2F6FAC2
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W8Y4F8W8Y4_HUMAN
Pannexin-2
PANX2
77Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036575147S → F in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs941735789Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0390921 – 134Missing in isoform 2. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_002677632 – 677YEARE…STVEF → SSSPPSTSRERS in isoform 1 and isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF398510 mRNA Translation: AAK91715.1
AF398511 mRNA Translation: AAK91716.1
AK299910 mRNA Translation: BAH13170.1
AL022328 Genomic DNA No translation available.
CCDSiCCDS14085.2 [Q96RD6-3]
CCDS54544.1 [Q96RD6-1]
RefSeqiNP_001153772.1, NM_001160300.1 [Q96RD6-1]
NP_443071.2, NM_052839.3 [Q96RD6-3]
UniGeneiHs.440092

Genome annotation databases

EnsembliENST00000159647; ENSP00000159647; ENSG00000073150 [Q96RD6-1]
ENST00000395842; ENSP00000379183; ENSG00000073150 [Q96RD6-3]
GeneIDi56666
KEGGihsa:56666
UCSCiuc003bjn.5 human [Q96RD6-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

Pannexin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF398510 mRNA Translation: AAK91715.1
AF398511 mRNA Translation: AAK91716.1
AK299910 mRNA Translation: BAH13170.1
AL022328 Genomic DNA No translation available.
CCDSiCCDS14085.2 [Q96RD6-3]
CCDS54544.1 [Q96RD6-1]
RefSeqiNP_001153772.1, NM_001160300.1 [Q96RD6-1]
NP_443071.2, NM_052839.3 [Q96RD6-3]
UniGeneiHs.440092

3D structure databases

ProteinModelPortaliQ96RD6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ96RD6, 1 interactor
STRINGi9606.ENSP00000379183

Protein family/group databases

TCDBi1.A.25.2.2 the gap junction-forming innexin (innexin) family

PTM databases

iPTMnetiQ96RD6
PhosphoSitePlusiQ96RD6

Polymorphism and mutation databases

BioMutaiPANX2
DMDMi296439257

Proteomic databases

PaxDbiQ96RD6
PeptideAtlasiQ96RD6
PRIDEiQ96RD6
ProteomicsDBi77943
77944 [Q96RD6-1]
77945 [Q96RD6-2]

Protocols and materials databases

DNASUi56666
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000159647; ENSP00000159647; ENSG00000073150 [Q96RD6-1]
ENST00000395842; ENSP00000379183; ENSG00000073150 [Q96RD6-3]
GeneIDi56666
KEGGihsa:56666
UCSCiuc003bjn.5 human [Q96RD6-3]

Organism-specific databases

CTDi56666
DisGeNETi56666
EuPathDBiHostDB:ENSG00000073150.13
GeneCardsiPANX2
H-InvDBiHIX0016605
HGNCiHGNC:8600 PANX2
HPAiHPA004624
HPA039117
MIMi608421 gene
neXtProtiNX_Q96RD6
OpenTargetsiENSG00000073150
PharmGKBiPA32930
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGKS Eukaryota
ENOG4110P9D LUCA
GeneTreeiENSGT00390000009703
HOGENOMiHOG000082414
HOVERGENiHBG053498
InParanoidiQ96RD6
KOiK20857
OMAiKSQFCDI
OrthoDBiEOG091G086D
PhylomeDBiQ96RD6
TreeFamiTF333142

Enzyme and pathway databases

ReactomeiR-HSA-112303 Electric Transmission Across Gap Junctions

Miscellaneous databases

ChiTaRSiPANX2 human
GenomeRNAii56666
PROiPR:Q96RD6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000073150 Expressed in 120 organ(s), highest expression level in prefrontal cortex
CleanExiHS_PANX2
ExpressionAtlasiQ96RD6 baseline and differential
GenevisibleiQ96RD6 HS

Family and domain databases

InterProiView protein in InterPro
IPR000990 Innexin
IPR039099 Pannexin
PANTHERiPTHR15759 PTHR15759, 1 hit
PfamiView protein in Pfam
PF00876 Innexin, 1 hit
PROSITEiView protein in PROSITE
PS51013 PANNEXIN, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPANX2_HUMAN
AccessioniPrimary (citable) accession number: Q96RD6
Secondary accession number(s): B7Z684, Q96RD5, Q9UGX8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: May 18, 2010
Last modified: November 7, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again