Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UAP56-interacting factor

Gene

FYTTD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for mRNA export from the nucleus to the cytoplasm. Acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Associates with spliced and unspliced mRNAs simultaneously with ALYREF/THOC4.1 Publication

GO - Molecular functioni

  • mRNA binding Source: UniProtKB
  • RNA binding Source: UniProtKB

GO - Biological processi

  • mRNA export from nucleus Source: UniProtKB

Keywordsi

Molecular functionRNA-binding
Biological processmRNA transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-109688 Cleavage of Growing Transcript in the Termination Region
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-72187 mRNA 3'-end processing

Names & Taxonomyi

Protein namesi
Recommended name:
UAP56-interacting factor
Alternative name(s):
Forty-two-three domain-containing protein 1
Short name:
Protein 40-2-3
Gene namesi
Name:FYTTD1
Synonyms:UIF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000122068.12
HGNCiHGNC:25407 FYTTD1
MIMi616933 gene
neXtProtiNX_Q96QD9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000122068
PharmGKBiPA134946373

Polymorphism and mutation databases

BioMutaiFYTTD1
DMDMi284018159

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002874411 – 318UAP56-interacting factorAdd BLAST318

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei14PhosphothreonineBy similarity1
Modified residuei16PhosphoserineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei61PhosphoserineCombined sources1
Modified residuei118PhosphoserineCombined sources1
Cross-linki140Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)
Cross-linki261Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ96QD9
MaxQBiQ96QD9
PaxDbiQ96QD9
PeptideAtlasiQ96QD9
PRIDEiQ96QD9
ProteomicsDBi77857
77858 [Q96QD9-2]
77859 [Q96QD9-3]
77860 [Q96QD9-4]
TopDownProteomicsiQ96QD9-1 [Q96QD9-1]

PTM databases

iPTMnetiQ96QD9
PhosphoSitePlusiQ96QD9

Expressioni

Tissue specificityi

Expressed in a wide variety of cancer types.1 Publication

Gene expression databases

BgeeiENSG00000122068 Expressed in 205 organ(s), highest expression level in quadriceps femoris
CleanExiHS_FYTTD1
ExpressionAtlasiQ96QD9 baseline and differential
GenevisibleiQ96QD9 HS

Organism-specific databases

HPAiHPA054474

Interactioni

Subunit structurei

Interacts with CHTOP (By similarity). Interacts with DDX39B/UAP56 and NXF1; interaction with DDX39B/UAP56 and NXF1 are mutually exclusive. Interacts with SSRP1; required for its recruitment to mRNAs.By similarity1 Publication

Protein-protein interaction databases

BioGridi123976, 93 interactors
DIPiDIP-62119N
IntActiQ96QD9, 18 interactors
MINTiQ96QD9
STRINGi9606.ENSP00000241502

Structurei

3D structure databases

ProteinModelPortaliQ96QD9
SMRiQ96QD9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi26 – 44UAP56-binding motifAdd BLAST19

Sequence similaritiesi

Belongs to the UIF family.Curated

Phylogenomic databases

eggNOGiENOG410II12 Eukaryota
ENOG4111TUX LUCA
GeneTreeiENSGT00390000012807
HOVERGENiHBG066549
InParanoidiQ96QD9
OMAiNQQKDTR
OrthoDBiEOG091G0GRX
PhylomeDBiQ96QD9
TreeFamiTF336232

Family and domain databases

InterProiView protein in InterPro
IPR009782 FYTTD1
PANTHERiPTHR21038 PTHR21038, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96QD9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRFGTRLVG ATATSSPPPK ARSNENLDKI DMSLDDIIKL NRKEGKKQNF
60 70 80 90 100
PRLNRRLLQQ SGAQQFRMRV RWGIQQNSGF GKTSLNRRGR VMPGKRRPNG
110 120 130 140 150
VITGLAARKT TGIRKGISPM NRPPLSDKNI EQYFPVLKRK ANLLRQNEGQ
160 170 180 190 200
RKPVAVLKRP SQLSRKNNIP ANFTRSGNKL NHQKDTRQAT FLFRRGLKVQ
210 220 230 240 250
AQLNTEQLLD DVVAKRTRQW RTSTTNGGIL TVSIDNPGAV QCPVTQKPRL
260 270 280 290 300
TRTAVPSFLT KREQSDVKKV PKGVPLQFDI NSVGKQTGMT LNERFGILKE
310
QRATLTYNKG GSRFVTVG
Length:318
Mass (Da):35,818
Last modified:January 19, 2010 - v3
Checksum:iEB2F37D1D423D13C
GO
Isoform 2 (identifier: Q96QD9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLD → MEPSVIMGN

Note: No experimental confirmation available.
Show »
Length:292
Mass (Da):33,004
Checksum:iE6E22D967F234F82
GO
Isoform 3 (identifier: Q96QD9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Note: No experimental confirmation available.
Show »
Length:251
Mass (Da):28,182
Checksum:i893BA69046662EA4
GO
Isoform 4 (identifier: Q96QD9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: N → K
     130-318: Missing.

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):14,524
Checksum:iDD28E3E18E6D18F9
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H9KVD1H9KVD1_HUMAN
UAP56-interacting factor
FYTTD1
121Annotation score:
H9KVC1H9KVC1_HUMAN
UAP56-interacting factor
FYTTD1
71Annotation score:
H9KVD5H9KVD5_HUMAN
UAP56-interacting factor
FYTTD1
126Annotation score:
H9KVC6H9KVC6_HUMAN
UAP56-interacting factor
FYTTD1
176Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti178N → S in BAH14679 (PubMed:14702039).Curated1
Sequence conflicti263E → G in BAB55284 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06241187R → H4 PublicationsCorresponds to variant dbSNP:rs3205525Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0386581 – 67Missing in isoform 3. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0386591 – 35MNRFG…DMSLD → MEPSVIMGN in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_038660129N → K in isoform 4. 1 Publication1
Alternative sequenceiVSP_038661130 – 318Missing in isoform 4. 1 PublicationAdd BLAST189

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ344094 mRNA Translation: CAC51432.1
AL136558 mRNA Translation: CAB66493.1
AK027672 mRNA Translation: BAB55284.1
AK296283 mRNA Translation: BAH12300.1
AK302546 mRNA Translation: BAH13737.1
AK303462 mRNA Translation: BAH13966.1
AK315019 mRNA Translation: BAG37509.1
AK316308 mRNA Translation: BAH14679.1
CR533502 mRNA Translation: CAG38533.1
AC024560 Genomic DNA No translation available.
AC055764 Genomic DNA No translation available.
CH471252 Genomic DNA Translation: EAW92240.1
BC035006 mRNA Translation: AAH35006.1
BC039734 mRNA Translation: AAH39734.1
CCDSiCCDS3329.1 [Q96QD9-1]
CCDS43196.2 [Q96QD9-2]
RefSeqiNP_001011537.2, NM_001011537.2 [Q96QD9-2]
NP_115664.2, NM_032288.6 [Q96QD9-1]
UniGeneiHs.277533

Genome annotation databases

EnsembliENST00000241502; ENSP00000241502; ENSG00000122068 [Q96QD9-1]
ENST00000415708; ENSP00000393746; ENSG00000122068 [Q96QD9-2]
ENST00000418169; ENSP00000400191; ENSG00000122068 [Q96QD9-4]
ENST00000424384; ENSP00000394631; ENSG00000122068 [Q96QD9-3]
GeneIDi84248
KEGGihsa:84248
UCSCiuc003fyi.3 human [Q96QD9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ344094 mRNA Translation: CAC51432.1
AL136558 mRNA Translation: CAB66493.1
AK027672 mRNA Translation: BAB55284.1
AK296283 mRNA Translation: BAH12300.1
AK302546 mRNA Translation: BAH13737.1
AK303462 mRNA Translation: BAH13966.1
AK315019 mRNA Translation: BAG37509.1
AK316308 mRNA Translation: BAH14679.1
CR533502 mRNA Translation: CAG38533.1
AC024560 Genomic DNA No translation available.
AC055764 Genomic DNA No translation available.
CH471252 Genomic DNA Translation: EAW92240.1
BC035006 mRNA Translation: AAH35006.1
BC039734 mRNA Translation: AAH39734.1
CCDSiCCDS3329.1 [Q96QD9-1]
CCDS43196.2 [Q96QD9-2]
RefSeqiNP_001011537.2, NM_001011537.2 [Q96QD9-2]
NP_115664.2, NM_032288.6 [Q96QD9-1]
UniGeneiHs.277533

3D structure databases

ProteinModelPortaliQ96QD9
SMRiQ96QD9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123976, 93 interactors
DIPiDIP-62119N
IntActiQ96QD9, 18 interactors
MINTiQ96QD9
STRINGi9606.ENSP00000241502

PTM databases

iPTMnetiQ96QD9
PhosphoSitePlusiQ96QD9

Polymorphism and mutation databases

BioMutaiFYTTD1
DMDMi284018159

Proteomic databases

EPDiQ96QD9
MaxQBiQ96QD9
PaxDbiQ96QD9
PeptideAtlasiQ96QD9
PRIDEiQ96QD9
ProteomicsDBi77857
77858 [Q96QD9-2]
77859 [Q96QD9-3]
77860 [Q96QD9-4]
TopDownProteomicsiQ96QD9-1 [Q96QD9-1]

Protocols and materials databases

DNASUi84248
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241502; ENSP00000241502; ENSG00000122068 [Q96QD9-1]
ENST00000415708; ENSP00000393746; ENSG00000122068 [Q96QD9-2]
ENST00000418169; ENSP00000400191; ENSG00000122068 [Q96QD9-4]
ENST00000424384; ENSP00000394631; ENSG00000122068 [Q96QD9-3]
GeneIDi84248
KEGGihsa:84248
UCSCiuc003fyi.3 human [Q96QD9-1]

Organism-specific databases

CTDi84248
EuPathDBiHostDB:ENSG00000122068.12
GeneCardsiFYTTD1
H-InvDBiHIX0003990
HGNCiHGNC:25407 FYTTD1
HPAiHPA054474
MIMi616933 gene
neXtProtiNX_Q96QD9
OpenTargetsiENSG00000122068
PharmGKBiPA134946373
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410II12 Eukaryota
ENOG4111TUX LUCA
GeneTreeiENSGT00390000012807
HOVERGENiHBG066549
InParanoidiQ96QD9
OMAiNQQKDTR
OrthoDBiEOG091G0GRX
PhylomeDBiQ96QD9
TreeFamiTF336232

Enzyme and pathway databases

ReactomeiR-HSA-109688 Cleavage of Growing Transcript in the Termination Region
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-72187 mRNA 3'-end processing

Miscellaneous databases

ChiTaRSiFYTTD1 human
GenomeRNAii84248
PROiPR:Q96QD9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122068 Expressed in 205 organ(s), highest expression level in quadriceps femoris
CleanExiHS_FYTTD1
ExpressionAtlasiQ96QD9 baseline and differential
GenevisibleiQ96QD9 HS

Family and domain databases

InterProiView protein in InterPro
IPR009782 FYTTD1
PANTHERiPTHR21038 PTHR21038, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUIF_HUMAN
AccessioniPrimary (citable) accession number: Q96QD9
Secondary accession number(s): A8MY74
, B2RCB2, B7Z3R4, B7Z7V1, B7Z8I0, B7ZAJ3, C9J7P6, C9JNG6, C9JTH3, C9JY50, Q96SL9, Q9BQI8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: January 19, 2010
Last modified: September 12, 2018
This is version 120 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again