Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q96QD9 (UIF_HUMAN)

Entry version 136 (07 Apr 2021)
Sequence version 3 (19 Jan 2010)
Previous versions | rss
Add a publicationFeedback
Protein

UAP56-interacting factor

Gene

FYTTD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for mRNA export from the nucleus to the cytoplasm. Acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Associates with spliced and unspliced mRNAs simultaneously with ALYREF/THOC4.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

  • mRNA export from nucleus Source: UniProtKB
Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding
Biological processmRNA transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96QD9

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-159236, Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-72187, mRNA 3'-end processing
R-HSA-73856, RNA Polymerase II Transcription Termination

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
UAP56-interacting factor
Alternative name(s):
Forty-two-three domain-containing protein 1
Short name:
Protein 40-2-3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FYTTD1
Synonyms:UIF
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:25407, FYTTD1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		616933, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96QD9

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000122068.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		84248

Open Targets

More...OpenTargetsi		ENSG00000122068

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134946373

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96QD9, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FYTTD1

Domain mapping of disease mutations (DMDM)

More...DMDMi		284018159

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002874411 – 318UAP56-interacting factorAdd BLAST318

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei14PhosphothreonineBy similarity1
Modified residuei16PhosphoserineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei61PhosphoserineCombined sources1
Modified residuei118PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki140Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)
Cross-linki261Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96QD9

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96QD9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96QD9

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96QD9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96QD9

PeptideAtlas

More...PeptideAtlasi		Q96QD9

PRoteomics IDEntifications database

More...PRIDEi		Q96QD9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		77857 [Q96QD9-1]
77858 [Q96QD9-2]
77859 [Q96QD9-3]
77860 [Q96QD9-4]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q96QD9-1 [Q96QD9-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96QD9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96QD9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in a wide variety of cancer types.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000122068, Expressed in quadriceps femoris and 217 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96QD9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96QD9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000122068, Tissue enhanced (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CHTOP (By similarity).

Interacts with DDX39B/UAP56 and NXF1; interaction with DDX39B/UAP56 and NXF1 are mutually exclusive.

Interacts with SSRP1; required for its recruitment to mRNAs.

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123976, 109 interactors

Database of interacting proteins

More...DIPi		DIP-62119N

Protein interaction database and analysis system

More...IntActi		Q96QD9, 56 interactors

Molecular INTeraction database

More...MINTi		Q96QD9

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000241502

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96QD9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96QD9

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi26 – 44UAP56-binding motifAdd BLAST19

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UIF family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QWD4, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000012807

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_1948055_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96QD9

Identification of Orthologs from Complete Genome Data

More...OMAi		YRKPEVQ

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96QD9

TreeFam database of animal gene trees

More...TreeFami		TF336232

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009782, FYTTD1

The PANTHER Classification System

More...PANTHERi		PTHR21038, PTHR21038, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96QD9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRFGTRLVG ATATSSPPPK ARSNENLDKI DMSLDDIIKL NRKEGKKQNF 
        60         70         80         90        100
PRLNRRLLQQ SGAQQFRMRV RWGIQQNSGF GKTSLNRRGR VMPGKRRPNG 
       110        120        130        140        150
VITGLAARKT TGIRKGISPM NRPPLSDKNI EQYFPVLKRK ANLLRQNEGQ 
       160        170        180        190        200
RKPVAVLKRP SQLSRKNNIP ANFTRSGNKL NHQKDTRQAT FLFRRGLKVQ 
       210        220        230        240        250
AQLNTEQLLD DVVAKRTRQW RTSTTNGGIL TVSIDNPGAV QCPVTQKPRL 
       260        270        280        290        300
TRTAVPSFLT KREQSDVKKV PKGVPLQFDI NSVGKQTGMT LNERFGILKE 
       310 
QRATLTYNKG GSRFVTVG
Length:318
Mass (Da):35,818
Last modified:January 19, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEB2F37D1D423D13C
GO
Isoform 2 (identifier: Q96QD9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLD → MEPSVIMGN

Show »
Length:292
Mass (Da):33,004
Checksum:iE6E22D967F234F82
GO
Isoform 3 (identifier: Q96QD9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Show »
Length:251
Mass (Da):28,182
Checksum:i893BA69046662EA4
GO
Isoform 4 (identifier: Q96QD9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: N → K
     130-318: Missing.

Show »
Length:129
Mass (Da):14,524
Checksum:iDD28E3E18E6D18F9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H9KVD1H9KVD1_HUMAN
Forty-two-three domain-containing p...
FYTTD1
121Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9KVC1H9KVC1_HUMAN
Forty-two-three domain-containing p...
FYTTD1
71Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9KVC6H9KVC6_HUMAN
Forty-two-three domain-containing p...
FYTTD1
176Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H9KVD5H9KVD5_HUMAN
Forty-two-three domain-containing p...
FYTTD1
126Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti178N → S in BAH14679 (PubMed:14702039).Curated1
Sequence conflicti263E → G in BAB55284 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06241187R → H4 PublicationsCorresponds to variant dbSNP:rs3205525Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0386581 – 67Missing in isoform 3. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0386591 – 35MNRFG…DMSLD → MEPSVIMGN in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_038660129N → K in isoform 4. 1 Publication1
Alternative sequenceiVSP_038661130 – 318Missing in isoform 4. 1 PublicationAdd BLAST189

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ344094 mRNA Translation: CAC51432.1
AL136558 mRNA Translation: CAB66493.1
AK027672 mRNA Translation: BAB55284.1
AK296283 mRNA Translation: BAH12300.1
AK302546 mRNA Translation: BAH13737.1
AK303462 mRNA Translation: BAH13966.1
AK315019 mRNA Translation: BAG37509.1
AK316308 mRNA Translation: BAH14679.1
CR533502 mRNA Translation: CAG38533.1
AC024560 Genomic DNA No translation available.
AC055764 Genomic DNA No translation available.
CH471252 Genomic DNA Translation: EAW92240.1
BC035006 mRNA Translation: AAH35006.1
BC039734 mRNA Translation: AAH39734.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3329.1 [Q96QD9-1]
CCDS43196.2 [Q96QD9-2]

NCBI Reference Sequences

More...RefSeqi		NP_001011537.2, NM_001011537.2 [Q96QD9-2]
NP_115664.2, NM_032288.6 [Q96QD9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000241502; ENSP00000241502; ENSG00000122068 [Q96QD9-1]
ENST00000415708; ENSP00000393746; ENSG00000122068 [Q96QD9-2]
ENST00000418169; ENSP00000400191; ENSG00000122068 [Q96QD9-4]
ENST00000424384; ENSP00000394631; ENSG00000122068 [Q96QD9-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84248

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84248

UCSC genome browser

More...UCSCi		uc003fyi.3, human [Q96QD9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ344094 mRNA Translation: CAC51432.1
AL136558 mRNA Translation: CAB66493.1
AK027672 mRNA Translation: BAB55284.1
AK296283 mRNA Translation: BAH12300.1
AK302546 mRNA Translation: BAH13737.1
AK303462 mRNA Translation: BAH13966.1
AK315019 mRNA Translation: BAG37509.1
AK316308 mRNA Translation: BAH14679.1
CR533502 mRNA Translation: CAG38533.1
AC024560 Genomic DNA No translation available.
AC055764 Genomic DNA No translation available.
CH471252 Genomic DNA Translation: EAW92240.1
BC035006 mRNA Translation: AAH35006.1
BC039734 mRNA Translation: AAH39734.1
CCDSiCCDS3329.1 [Q96QD9-1]
CCDS43196.2 [Q96QD9-2]
RefSeqiNP_001011537.2, NM_001011537.2 [Q96QD9-2]
NP_115664.2, NM_032288.6 [Q96QD9-1]

3D structure databases

SMRiQ96QD9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123976, 109 interactors
DIPiDIP-62119N
IntActiQ96QD9, 56 interactors
MINTiQ96QD9
STRINGi9606.ENSP00000241502

PTM databases

iPTMnetiQ96QD9
PhosphoSitePlusiQ96QD9

Genetic variation databases

BioMutaiFYTTD1
DMDMi284018159

Proteomic databases

EPDiQ96QD9
jPOSTiQ96QD9
MassIVEiQ96QD9
MaxQBiQ96QD9
PaxDbiQ96QD9
PeptideAtlasiQ96QD9
PRIDEiQ96QD9
ProteomicsDBi77857 [Q96QD9-1]
77858 [Q96QD9-2]
77859 [Q96QD9-3]
77860 [Q96QD9-4]
TopDownProteomicsiQ96QD9-1 [Q96QD9-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		54015, 133 antibodies

The DNASU plasmid repository

More...DNASUi		84248

Genome annotation databases

EnsembliENST00000241502; ENSP00000241502; ENSG00000122068 [Q96QD9-1]
ENST00000415708; ENSP00000393746; ENSG00000122068 [Q96QD9-2]
ENST00000418169; ENSP00000400191; ENSG00000122068 [Q96QD9-4]
ENST00000424384; ENSP00000394631; ENSG00000122068 [Q96QD9-3]
GeneIDi84248
KEGGihsa:84248
UCSCiuc003fyi.3, human [Q96QD9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84248
DisGeNETi84248

GeneCards: human genes, protein and diseases

More...GeneCardsi		FYTTD1
HGNCiHGNC:25407, FYTTD1
HPAiENSG00000122068, Tissue enhanced (skeletal)
MIMi616933, gene
neXtProtiNX_Q96QD9
OpenTargetsiENSG00000122068
PharmGKBiPA134946373
VEuPathDBiHostDB:ENSG00000122068.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QWD4, Eukaryota
GeneTreeiENSGT00390000012807
HOGENOMiCLU_1948055_0_0_1
InParanoidiQ96QD9
OMAiYRKPEVQ
PhylomeDBiQ96QD9
TreeFamiTF336232

Enzyme and pathway databases

PathwayCommonsiQ96QD9
ReactomeiR-HSA-159236, Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-72187, mRNA 3'-end processing
R-HSA-73856, RNA Polymerase II Transcription Termination

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84248, 4 hits in 993 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FYTTD1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84248
PharosiQ96QD9, Tbio

Protein Ontology

More...PROi		PR:Q96QD9
RNActiQ96QD9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000122068, Expressed in quadriceps femoris and 217 other tissues
ExpressionAtlasiQ96QD9, baseline and differential
GenevisibleiQ96QD9, HS

Family and domain databases

InterProiView protein in InterPro
IPR009782, FYTTD1
PANTHERiPTHR21038, PTHR21038, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUIF_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96QD9
Secondary accession number(s): A8MY74
, B2RCB2, B7Z3R4, B7Z7V1, B7Z8I0, B7ZAJ3, C9J7P6, C9JNG6, C9JTH3, C9JY50, Q96SL9, Q9BQI8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: January 19, 2010
Last modified: April 7, 2021
This is version 136 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again