Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 15

Gene

CDK15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Serine/threonine-protein kinase that acts like an antiapoptotic protein that counters TRAIL/TNFSF10-induced apoptosis by inducing phosphorylation of BIRC5 at 'Thr-34'.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei132ATPPROSITE-ProRule annotation1
Active sitei224Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi109 – 117ATPPROSITE-ProRule annotation9

GO - Molecular functioni

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22 2681
SignaLinkiQ96Q40

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 15 (EC:2.7.11.221 Publication)
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
Cell division protein kinase 15
Serine/threonine-protein kinase ALS2CR7
Serine/threonine-protein kinase PFTAIRE-2
Gene namesi
Name:CDK15
Synonyms:ALS2CR7, PFTK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000138395.14
HGNCiHGNC:14434 CDK15
MIMi616147 gene
neXtProtiNX_Q96Q40

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi65061
OpenTargetsiENSG00000138395
PharmGKBiPA165696414

Chemistry databases

ChEMBLiCHEMBL5856
DrugBankiDB00171 Adenosine triphosphate

Polymorphism and mutation databases

BioMutaiCDK15
DMDMi290457634

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000856191 – 435Cyclin-dependent kinase 15Add BLAST435

Proteomic databases

EPDiQ96Q40
MaxQBiQ96Q40
PaxDbiQ96Q40
PeptideAtlasiQ96Q40
PRIDEiQ96Q40
ProteomicsDBi77819
77821 [Q96Q40-3]
77822 [Q96Q40-4]

PTM databases

iPTMnetiQ96Q40
PhosphoSitePlusiQ96Q40

Expressioni

Gene expression databases

BgeeiENSG00000138395 Expressed in 119 organ(s), highest expression level in corpus epididymis
CleanExiHS_PFTK2
ExpressionAtlasiQ96Q40 baseline and differential
GenevisibleiQ96Q40 HS

Organism-specific databases

HPAiHPA015786

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122381, 117 interactors
IntActiQ96Q40, 10 interactors
MINTiQ96Q40
STRINGi9606.ENSP00000260967

Chemistry databases

BindingDBiQ96Q40

Structurei

3D structure databases

ProteinModelPortaliQ96Q40
SMRiQ96Q40
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 387Protein kinasePROSITE-ProRule annotationAdd BLAST285

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0594 Eukaryota
ENOG410XPP3 LUCA
GeneTreeiENSGT00900000140869
HOVERGENiHBG014652
InParanoidiQ96Q40
KOiK15594
OMAiLKPEMCD
OrthoDBiEOG091G0CH0
PhylomeDBiQ96Q40
TreeFamiTF106508

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: Q96Q40-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGQELCAKTV QPGCSCYHCS EGGEAHSCRR SQPETTEAAF KLTDLKEASC
60 70 80 90 100
SMTSFHPRGL QAARAQKFKS KRPRSNSDCF QEEDLRQGFQ WRKSLPFGAA
110 120 130 140 150
SSYLNLEKLG EGSYATVYKG ISRINGQLVA LKVISMNAEE GVPFTAIREA
160 170 180 190 200
SLLKGLKHAN IVLLHDIIHT KETLTFVFEY MHTDLAQYMS QHPGGLHPHN
210 220 230 240 250
VRLFMFQLLR GLAYIHHQHV LHRDLKPQNL LISHLGELKL ADFGLARAKS
260 270 280 290 300
IPSQTYSSEV VTLWYRPPDA LLGATEYSSE LDIWGAGCIF IEMFQGQPLF
310 320 330 340 350
PGVSNILEQL EKIWEVLGVP TEDTWPGVSK LPNYNPEWFP LPTPRSLHVV
360 370 380 390 400
WNRLGRVPEA EDLASQMLKG FPRDRVSAQE ALVHDYFSAL PSQLYQLPDE
410 420 430
ESLFTVSGVR LKPEMCDLLA SYQKGHHPAQ FSKCW
Length:435
Mass (Da):49,023
Last modified:March 2, 2010 - v2
Checksum:iB415BBBE322EAB33
GO
Isoform 3 (identifier: Q96Q40-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-435: Missing.

Note: No experimental confirmation available.
Show »
Length:400
Mass (Da):45,046
Checksum:iAE9AD984E40A3BF6
GO
Isoform 4 (identifier: Q96Q40-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.

Show »
Length:384
Mass (Da):43,574
Checksum:i6CAAD08E6E0E43EB
GO
Isoform 5 (identifier: Q96Q40-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-405: Missing.

Note: Gene prediction based on EST data. May be due to competing acceptor splice site.
Show »
Length:429
Mass (Da):48,316
Checksum:i37ABAD0BA1B43881
GO
Isoform 6 (identifier: Q96Q40-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-202: Missing.
     337-366: EWFPLPTPRSLHVVWNRLGRVPEAEDLASQ → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF
     367-435: Missing.

Show »
Length:345
Mass (Da):38,586
Checksum:iA51640CA8C119F43
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WDP7F8WDP7_HUMAN
Cyclin-dependent kinase 15
CDK15
54Annotation score:

Sequence cautioni

The sequence AAH38807 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04201664R → G1 PublicationCorresponds to variant dbSNP:rs34776344Ensembl.1
Natural variantiVAR_04201793K → E in a renal clear cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_042018127Q → R1 PublicationCorresponds to variant dbSNP:rs56135556Ensembl.1
Natural variantiVAR_042019255T → I1 PublicationCorresponds to variant dbSNP:rs34851370Ensembl.1
Natural variantiVAR_042020276E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0387651 – 51Missing in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_059406182 – 202Missing in isoform 6. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_059407337 – 366EWFPL…DLASQ → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 6. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_059408367 – 435Missing in isoform 6. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_047226400 – 405Missing in isoform 5. Curated6
Alternative sequenceiVSP_023745401 – 435Missing in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053308 mRNA Translation: BAB69017.1
AK131512 mRNA Translation: BAD18656.1
AK292434 mRNA Translation: BAF85123.1
AC007242 Genomic DNA Translation: AAX93182.1
AC007358 Genomic DNA Translation: AAX88914.1
CH471063 Genomic DNA Translation: EAW70295.1
CH471063 Genomic DNA Translation: EAW70297.1
BC038807 mRNA Translation: AAH38807.1 Different initiation.
CCDSiCCDS2350.1 [Q96Q40-4]
CCDS58746.1 [Q96Q40-3]
CCDS58747.1 [Q96Q40-5]
RefSeqiNP_001248364.1, NM_001261435.1 [Q96Q40-5]
NP_001248365.1, NM_001261436.1 [Q96Q40-3]
NP_631897.1, NM_139158.2 [Q96Q40-4]
XP_005246838.1, XM_005246781.3 [Q96Q40-1]
XP_005246839.1, XM_005246782.4 [Q96Q40-4]
UniGeneiHs.348711

Genome annotation databases

EnsembliENST00000260967; ENSP00000260967; ENSG00000138395 [Q96Q40-4]
ENST00000410091; ENSP00000386901; ENSG00000138395 [Q96Q40-4]
ENST00000434439; ENSP00000412775; ENSG00000138395 [Q96Q40-3]
ENST00000450471; ENSP00000406472; ENSG00000138395 [Q96Q40-5]
GeneIDi65061
KEGGihsa:65061
UCSCiuc002uys.4 human [Q96Q40-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCDK15_HUMAN
AccessioniPrimary (citable) accession number: Q96Q40
Secondary accession number(s): A8K8R9
, B8ZZX0, C9J1N8, C9K003, F8W6H8, Q4ZG86, Q53TV1, Q6ZMR9, Q8IUP1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: March 2, 2010
Last modified: September 12, 2018
This is version 155 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again