Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 166 (16 Oct 2019)
Sequence version 2 (02 Mar 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cyclin-dependent kinase 15

Gene

CDK15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine-protein kinase that acts like an antiapoptotic protein that counters TRAIL/TNFSF10-induced apoptosis by inducing phosphorylation of BIRC5 at 'Thr-34'.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei132ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei224Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi109 – 117ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.11.22 2681

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q96Q40

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-dependent kinase 15 (EC:2.7.11.221 Publication)
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
Cell division protein kinase 15
Serine/threonine-protein kinase ALS2CR7
Serine/threonine-protein kinase PFTAIRE-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDK15
Synonyms:ALS2CR7, PFTK2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14434 CDK15

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616147 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96Q40

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
65061

Open Targets

More...
OpenTargetsi
ENSG00000138395

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165696414

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96Q40

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5856

Drug and drug target database

More...
DrugBanki
DB00171 ATP
DB06486 Enzastaurin
DB12010 Fostamatinib

DrugCentral

More...
DrugCentrali
Q96Q40

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDK15

Domain mapping of disease mutations (DMDM)

More...
DMDMi
290457634

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000856191 – 435Cyclin-dependent kinase 15Add BLAST435

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96Q40

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96Q40

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96Q40

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96Q40

PeptideAtlas

More...
PeptideAtlasi
Q96Q40

PRoteomics IDEntifications database

More...
PRIDEi
Q96Q40

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
29785
77819 [Q96Q40-1]
77821 [Q96Q40-3]
77822 [Q96Q40-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96Q40

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96Q40

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138395 Expressed in 119 organ(s), highest expression level in corpus epididymis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96Q40 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96Q40 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA015786

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122381, 119 interactors

Protein interaction database and analysis system

More...
IntActi
Q96Q40, 95 interactors

Molecular INTeraction database

More...
MINTi
Q96Q40

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000406472

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q96Q40

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96Q40

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini103 – 387Protein kinasePROSITE-ProRule annotationAdd BLAST285

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0594 Eukaryota
ENOG410XPP3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159606

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96Q40

KEGG Orthology (KO)

More...
KOi
K15594

Identification of Orthologs from Complete Genome Data

More...
OMAi
VISMNEE

Database of Orthologous Groups

More...
OrthoDBi
1010560at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96Q40

TreeFam database of animal gene trees

More...
TreeFami
TF106508

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96Q40-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGQELCAKTV QPGCSCYHCS EGGEAHSCRR SQPETTEAAF KLTDLKEASC
60 70 80 90 100
SMTSFHPRGL QAARAQKFKS KRPRSNSDCF QEEDLRQGFQ WRKSLPFGAA
110 120 130 140 150
SSYLNLEKLG EGSYATVYKG ISRINGQLVA LKVISMNAEE GVPFTAIREA
160 170 180 190 200
SLLKGLKHAN IVLLHDIIHT KETLTFVFEY MHTDLAQYMS QHPGGLHPHN
210 220 230 240 250
VRLFMFQLLR GLAYIHHQHV LHRDLKPQNL LISHLGELKL ADFGLARAKS
260 270 280 290 300
IPSQTYSSEV VTLWYRPPDA LLGATEYSSE LDIWGAGCIF IEMFQGQPLF
310 320 330 340 350
PGVSNILEQL EKIWEVLGVP TEDTWPGVSK LPNYNPEWFP LPTPRSLHVV
360 370 380 390 400
WNRLGRVPEA EDLASQMLKG FPRDRVSAQE ALVHDYFSAL PSQLYQLPDE
410 420 430
ESLFTVSGVR LKPEMCDLLA SYQKGHHPAQ FSKCW
Length:435
Mass (Da):49,023
Last modified:March 2, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB415BBBE322EAB33
GO
Isoform 3 (identifier: Q96Q40-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-435: Missing.

Note: No experimental confirmation available.
Show »
Length:400
Mass (Da):45,046
Checksum:iAE9AD984E40A3BF6
GO
Isoform 4 (identifier: Q96Q40-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.

Show »
Length:384
Mass (Da):43,574
Checksum:i6CAAD08E6E0E43EB
GO
Isoform 5 (identifier: Q96Q40-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-405: Missing.

Note: Gene prediction based on EST data. May be due to competing acceptor splice site.
Show »
Length:429
Mass (Da):48,316
Checksum:i37ABAD0BA1B43881
GO
Isoform 6 (identifier: Q96Q40-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-202: Missing.
     337-366: EWFPLPTPRSLHVVWNRLGRVPEAEDLASQ → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF
     367-435: Missing.

Show »
Length:345
Mass (Da):38,586
Checksum:iA51640CA8C119F43
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WDP7F8WDP7_HUMAN
Cyclin-dependent kinase 15
CDK15
54Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH38807 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04201664R → G1 PublicationCorresponds to variant dbSNP:rs34776344Ensembl.1
Natural variantiVAR_04201793K → E in a renal clear cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_042018127Q → R1 PublicationCorresponds to variant dbSNP:rs56135556Ensembl.1
Natural variantiVAR_042019255T → I1 PublicationCorresponds to variant dbSNP:rs34851370Ensembl.1
Natural variantiVAR_042020276E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1490814436Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0387651 – 51Missing in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_059406182 – 202Missing in isoform 6. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_059407337 – 366EWFPL…DLASQ → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 6. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_059408367 – 435Missing in isoform 6. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_047226400 – 405Missing in isoform 5. Curated6
Alternative sequenceiVSP_023745401 – 435Missing in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB053308 mRNA Translation: BAB69017.1
AK131512 mRNA Translation: BAD18656.1
AK292434 mRNA Translation: BAF85123.1
AC007242 Genomic DNA Translation: AAX93182.1
AC007358 Genomic DNA Translation: AAX88914.1
CH471063 Genomic DNA Translation: EAW70295.1
CH471063 Genomic DNA Translation: EAW70297.1
BC038807 mRNA Translation: AAH38807.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2350.1 [Q96Q40-4]
CCDS58746.1 [Q96Q40-3]
CCDS58747.1 [Q96Q40-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001248364.1, NM_001261435.1 [Q96Q40-5]
NP_001248365.1, NM_001261436.1 [Q96Q40-3]
NP_631897.1, NM_139158.2 [Q96Q40-4]
XP_005246838.1, XM_005246781.3
XP_005246839.1, XM_005246782.4 [Q96Q40-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000260967; ENSP00000260967; ENSG00000138395 [Q96Q40-4]
ENST00000410091; ENSP00000386901; ENSG00000138395 [Q96Q40-4]
ENST00000434439; ENSP00000412775; ENSG00000138395 [Q96Q40-3]
ENST00000450471; ENSP00000406472; ENSG00000138395 [Q96Q40-5]
ENST00000652192; ENSP00000498608; ENSG00000138395 [Q96Q40-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65061

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65061

UCSC genome browser

More...
UCSCi
uc002uys.4 human [Q96Q40-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053308 mRNA Translation: BAB69017.1
AK131512 mRNA Translation: BAD18656.1
AK292434 mRNA Translation: BAF85123.1
AC007242 Genomic DNA Translation: AAX93182.1
AC007358 Genomic DNA Translation: AAX88914.1
CH471063 Genomic DNA Translation: EAW70295.1
CH471063 Genomic DNA Translation: EAW70297.1
BC038807 mRNA Translation: AAH38807.1 Different initiation.
CCDSiCCDS2350.1 [Q96Q40-4]
CCDS58746.1 [Q96Q40-3]
CCDS58747.1 [Q96Q40-5]
RefSeqiNP_001248364.1, NM_001261435.1 [Q96Q40-5]
NP_001248365.1, NM_001261436.1 [Q96Q40-3]
NP_631897.1, NM_139158.2 [Q96Q40-4]
XP_005246838.1, XM_005246781.3
XP_005246839.1, XM_005246782.4 [Q96Q40-4]

3D structure databases

SMRiQ96Q40
ModBaseiSearch...

Protein-protein interaction databases

BioGridi122381, 119 interactors
IntActiQ96Q40, 95 interactors
MINTiQ96Q40
STRINGi9606.ENSP00000406472

Chemistry databases

BindingDBiQ96Q40
ChEMBLiCHEMBL5856
DrugBankiDB00171 ATP
DB06486 Enzastaurin
DB12010 Fostamatinib
DrugCentraliQ96Q40

PTM databases

iPTMnetiQ96Q40
PhosphoSitePlusiQ96Q40

Polymorphism and mutation databases

BioMutaiCDK15
DMDMi290457634

Proteomic databases

jPOSTiQ96Q40
MassIVEiQ96Q40
MaxQBiQ96Q40
PaxDbiQ96Q40
PeptideAtlasiQ96Q40
PRIDEiQ96Q40
ProteomicsDBi29785
77819 [Q96Q40-1]
77821 [Q96Q40-3]
77822 [Q96Q40-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
65061

Genome annotation databases

EnsembliENST00000260967; ENSP00000260967; ENSG00000138395 [Q96Q40-4]
ENST00000410091; ENSP00000386901; ENSG00000138395 [Q96Q40-4]
ENST00000434439; ENSP00000412775; ENSG00000138395 [Q96Q40-3]
ENST00000450471; ENSP00000406472; ENSG00000138395 [Q96Q40-5]
ENST00000652192; ENSP00000498608; ENSG00000138395 [Q96Q40-1]
GeneIDi65061
KEGGihsa:65061
UCSCiuc002uys.4 human [Q96Q40-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65061
DisGeNETi65061

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDK15
HGNCiHGNC:14434 CDK15
HPAiHPA015786
MIMi616147 gene
neXtProtiNX_Q96Q40
OpenTargetsiENSG00000138395
PharmGKBiPA165696414

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0594 Eukaryota
ENOG410XPP3 LUCA
GeneTreeiENSGT00940000159606
InParanoidiQ96Q40
KOiK15594
OMAiVISMNEE
OrthoDBi1010560at2759
PhylomeDBiQ96Q40
TreeFamiTF106508

Enzyme and pathway databases

BRENDAi2.7.11.22 2681
SignaLinkiQ96Q40

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDK15 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65061
PharosiQ96Q40

Protein Ontology

More...
PROi
PR:Q96Q40

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000138395 Expressed in 119 organ(s), highest expression level in corpus epididymis
ExpressionAtlasiQ96Q40 baseline and differential
GenevisibleiQ96Q40 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCDK15_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96Q40
Secondary accession number(s): A8K8R9
, B8ZZX0, C9J1N8, C9K003, F8W6H8, Q4ZG86, Q53TV1, Q6ZMR9, Q8IUP1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: March 2, 2010
Last modified: October 16, 2019
This is version 166 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again