Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96Q07 (BTBD9_HUMAN)

Entry version 146 (08 May 2019)
Sequence version 2 (29 Aug 2003)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

BTB/POZ domain-containing protein 9

Gene

BTBD9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
BTB/POZ domain-containing protein 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BTBD9
Synonyms:KIAA1880
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:21228 BTBD9

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611237 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96Q07

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Restless legs syndrome 6 (RLS6)2 Publications
Disease susceptibility may be associated with variations affecting the gene represented in this entry.
Disease descriptionA neurologic sleep/wake disorder characterized by uncomfortable and unpleasant sensations in the legs that appear at rest, usually at night, inducing an irresistible desire to move the legs. The disorder results in nocturnal insomnia and chronic sleep deprivation. The majority of patients also have periodic limb movements in sleep, which are characterized by involuntary, highly stereotypical, regularly occurring limb movements that occur during sleep.
Related information in OMIM

Organism-specific databases

DisGeNET

More...DisGeNETi		114781
MIMi611185 phenotype

Open Targets

More...OpenTargetsi		ENSG00000183826

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134891920

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BTBD9

Domain mapping of disease mutations (DMDM)

More...DMDMi		34395545

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001862171 – 612BTB/POZ domain-containing protein 9Add BLAST612

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96Q07

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96Q07

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96Q07

PeptideAtlas

More...PeptideAtlasi		Q96Q07

PRoteomics IDEntifications database

More...PRIDEi		Q96Q07

ProteomicsDB human proteome resource

More...ProteomicsDBi		77805
77806 [Q96Q07-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96Q07

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96Q07

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in the brain (at protein level) (PubMed:22658601). Moderately expressed in all specific brain regions examined (PubMed:11572484). Expressed in the dopaminergic neurons of the substantia nigra and A11 neurons (PubMed:22658601). Highly expressed in kidney and moderately expressed in all other adult and fetal tissues (PubMed:11572484).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000183826 Expressed in 158 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96Q07 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96Q07 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA041930

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		125343, 38 interactors

Protein interaction database and analysis system

More...IntActi		Q96Q07, 5 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000418751

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96Q07

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini36 – 104BTBPROSITE-ProRule annotationAdd BLAST69
Domaini142 – 240BACKAdd BLAST99

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4350 Eukaryota
ENOG410Z7D9 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158298

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000007577

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96Q07

KEGG Orthology (KO)

More...KOi		K10481

Identification of Orthologs from Complete Genome Data

More...OMAi		IINHIRL

Database of Orthologous Groups

More...OrthoDBi		607923at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96Q07

TreeFam database of animal gene trees

More...TreeFami		TF318638

Family and domain databases

Conserved Domains Database

More...CDDi		cd14822 BACK_BTBD9_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.120.260, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011705 BACK
IPR000210 BTB/POZ_dom
IPR034091 BTBD9_BACK-like_dom
IPR000421 FA58C
IPR008979 Galactose-bd-like_sf
IPR011333 SKP1/BTB/POZ_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07707 BACK, 1 hit
PF00651 BTB, 1 hit
PF00754 F5_F8_type_C, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00875 BACK, 1 hit
SM00225 BTB, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49785 SSF49785, 2 hits
SSF54695 SSF54695, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50097 BTB, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96Q07-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSNSHPLRPF TAVGEIDHVH ILSEHIGALL IGEEYGDVTF VVEKKRFPAH 
        60         70         80         90        100
RVILAARCQY FRALLYGGMR ESQPEAEIPL QDTTAEAFTM LLKYIYTGRA 
       110        120        130        140        150
TLTDEKEEVL LDFLSLAHKY GFPELEDSTS EYLCTILNIQ NVCMTFDVAS 
       160        170        180        190        200
LYSLPKLTCM CCMFMDRNAQ EVLSSEGFLS LSKTALLNIV LRDSFAAPEK 
       210        220        230        240        250
DIFLALLNWC KHNSKENHAE IMQAVRLPLM SLTELLNVVR PSGLLSPDAI 
       260        270        280        290        300
LDAIKVRSES RDMDLNYRGM LIPEENIATM KYGAQVVKGE LKSALLDGDT 
       310        320        330        340        350
QNYDLDHGFS RHPIDDDCRS GIEIKLGQPS IINHIRILLW DRDSRSYSYF 
       360        370        380        390        400
IEVSMDELDW VRVIDHSQYL CRSWQKLYFP ARVCRYIRIV GTHNTVNKIF 
       410        420        430        440        450
HIVAFECMFT NKTFTLEKGL IVPMENVATI ADCASVIEGV SRSRNALLNG 
       460        470        480        490        500
DTKNYDWDSG YTCHQLGSGA IVVQLAQPYM IGSIRLLLWD CDDRSYSYYV 
       510        520        530        540        550
EVSTNQQQWT MVADRTKVSC KSWQSVTFER QPASFIRIVG THNTANEVFH 
       560        570        580        590        600
CVHFECPEQQ SSQKEENSEE SGTGDTSLAG QQLDSHALRA PSGSSLPSSP 
       610 
GSNSRSPNRQ HQ
Length:612
Mass (Da):69,188
Last modified:August 29, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i19A869F476064046
GO
Isoform 2 (identifier: Q96Q07-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: MSNSHPLRPFTAVGEIDHVHILSEHIGALLIGEEYGDVTFVVEKKRFPAHRVILAARCQYF → MC
     383-383: V → VCSGDGVSLWCPLWSRTPELKQSSLLGLPK

Note: No experimental confirmation available.
Show »
Length:582
Mass (Da):65,664
Checksum:iBA186E37865D1C23
GO
Isoform 3 (identifier: Q96Q07-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: Missing.

Show »
Length:544
Mass (Da):61,558
Checksum:i8472FADC26FFA004
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C5Z6H7C5Z6_HUMAN
BTB/POZ domain-containing protein 9
BTBD9
318Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J8E4C9J8E4_HUMAN
BTB/POZ domain-containing protein 9
BTBD9
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSF4A0A0A0MSF4_HUMAN
BTB/POZ domain-containing protein 9
BTBD9
354Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSF2A0A0A0MSF2_HUMAN
BTB/POZ domain-containing protein 9
BTBD9
385Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JVC1C9JVC1_HUMAN
BTB/POZ domain-containing protein 9
BTBD9
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB67773 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti331I → V in BAB71514 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0442471 – 68Missing in isoform 3. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0425431 – 61MSNSH…RCQYF → MC in isoform 2. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_042544383V → VCSGDGVSLWCPLWSRTPEL KQSSLLGLPK in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB067467 mRNA Translation: BAB67773.1 Different initiation.
AL031905 Genomic DNA No translation available.
AL033518 Genomic DNA No translation available.
AL079341 Genomic DNA No translation available.
AL355345 Genomic DNA No translation available.
AL451162 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03961.1
BC101354 mRNA Translation: AAI01355.1
BC101355 mRNA Translation: AAI01356.1
BC101357 mRNA Translation: AAI01358.1
AK057507 mRNA Translation: BAB71514.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS43458.1 [Q96Q07-3]
CCDS47418.1 [Q96Q07-1]
CCDS54998.1 [Q96Q07-2]

NCBI Reference Sequences

More...RefSeqi		NP_001092742.1, NM_001099272.1 [Q96Q07-1]
NP_001165889.1, NM_001172418.1 [Q96Q07-2]
NP_443125.1, NM_052893.1 [Q96Q07-1]
NP_689946.2, NM_152733.2 [Q96Q07-3]
XP_011512581.1, XM_011514279.2 [Q96Q07-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000314100; ENSP00000323408; ENSG00000183826 [Q96Q07-3]
ENST00000419706; ENSP00000415365; ENSG00000183826 [Q96Q07-2]
ENST00000481247; ENSP00000418751; ENSG00000183826 [Q96Q07-1]
ENST00000649492; ENSP00000497066; ENSG00000183826 [Q96Q07-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		114781

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:114781

UCSC genome browser

More...UCSCi		uc003ony.4 human [Q96Q07-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067467 mRNA Translation: BAB67773.1 Different initiation.
AL031905 Genomic DNA No translation available.
AL033518 Genomic DNA No translation available.
AL079341 Genomic DNA No translation available.
AL355345 Genomic DNA No translation available.
AL451162 Genomic DNA No translation available.
CH471081 Genomic DNA Translation: EAX03961.1
BC101354 mRNA Translation: AAI01355.1
BC101355 mRNA Translation: AAI01356.1
BC101357 mRNA Translation: AAI01358.1
AK057507 mRNA Translation: BAB71514.1
CCDSiCCDS43458.1 [Q96Q07-3]
CCDS47418.1 [Q96Q07-1]
CCDS54998.1 [Q96Q07-2]
RefSeqiNP_001092742.1, NM_001099272.1 [Q96Q07-1]
NP_001165889.1, NM_001172418.1 [Q96Q07-2]
NP_443125.1, NM_052893.1 [Q96Q07-1]
NP_689946.2, NM_152733.2 [Q96Q07-3]
XP_011512581.1, XM_011514279.2 [Q96Q07-1]

3D structure databases

SMRiQ96Q07
ModBaseiSearch...

Protein-protein interaction databases

BioGridi125343, 38 interactors
IntActiQ96Q07, 5 interactors
STRINGi9606.ENSP00000418751

PTM databases

iPTMnetiQ96Q07
PhosphoSitePlusiQ96Q07

Polymorphism and mutation databases

BioMutaiBTBD9
DMDMi34395545

Proteomic databases

jPOSTiQ96Q07
MaxQBiQ96Q07
PaxDbiQ96Q07
PeptideAtlasiQ96Q07
PRIDEiQ96Q07
ProteomicsDBi77805
77806 [Q96Q07-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314100; ENSP00000323408; ENSG00000183826 [Q96Q07-3]
ENST00000419706; ENSP00000415365; ENSG00000183826 [Q96Q07-2]
ENST00000481247; ENSP00000418751; ENSG00000183826 [Q96Q07-1]
ENST00000649492; ENSP00000497066; ENSG00000183826 [Q96Q07-1]
GeneIDi114781
KEGGihsa:114781
UCSCiuc003ony.4 human [Q96Q07-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		114781
DisGeNETi114781

GeneCards: human genes, protein and diseases

More...GeneCardsi		BTBD9

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0005845
HGNCiHGNC:21228 BTBD9
HPAiHPA041930
MIMi611185 phenotype
611237 gene
neXtProtiNX_Q96Q07
OpenTargetsiENSG00000183826
PharmGKBiPA134891920

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4350 Eukaryota
ENOG410Z7D9 LUCA
GeneTreeiENSGT00940000158298
HOGENOMiHOG000007577
InParanoidiQ96Q07
KOiK10481
OMAiIINHIRL
OrthoDBi607923at2759
PhylomeDBiQ96Q07
TreeFamiTF318638

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BTBD9 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		114781

Protein Ontology

More...PROi		PR:Q96Q07

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000183826 Expressed in 158 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ96Q07 baseline and differential
GenevisibleiQ96Q07 HS

Family and domain databases

CDDicd14822 BACK_BTBD9_like, 1 hit
Gene3Di2.60.120.260, 2 hits
InterProiView protein in InterPro
IPR011705 BACK
IPR000210 BTB/POZ_dom
IPR034091 BTBD9_BACK-like_dom
IPR000421 FA58C
IPR008979 Galactose-bd-like_sf
IPR011333 SKP1/BTB/POZ_sf
PfamiView protein in Pfam
PF07707 BACK, 1 hit
PF00651 BTB, 1 hit
PF00754 F5_F8_type_C, 2 hits
SMARTiView protein in SMART
SM00875 BACK, 1 hit
SM00225 BTB, 1 hit
SUPFAMiSSF49785 SSF49785, 2 hits
SSF54695 SSF54695, 1 hit
PROSITEiView protein in PROSITE
PS50097 BTB, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBTBD9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96Q07
Secondary accession number(s): Q494V9, Q494W1, Q96M00
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: August 29, 2003
Last modified: May 8, 2019
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again