Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Formin-like protein 2

Gene

FMNL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics.1 Publication

GO - Molecular functioni

GO - Biological processi

  • cortical actin cytoskeleton organization Source: UniProtKB
  • cytoskeleton organization Source: UniProtKB
  • regulation of cell morphogenesis Source: UniProtKB

Enzyme and pathway databases

ReactomeiR-HSA-5663220 RHO GTPases Activate Formins

Names & Taxonomyi

Protein namesi
Recommended name:
Formin-like protein 2
Alternative name(s):
Formin homology 2 domain-containing protein 2
Gene namesi
Name:FMNL2
Synonyms:FHOD2, KIAA1902
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000157827.19
HGNCiHGNC:18267 FMNL2
MIMi616285 gene
neXtProtiNX_Q96PY5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi114793
OpenTargetsiENSG00000157827
PharmGKBiPA28144

Polymorphism and mutation databases

BioMutaiFMNL2
DMDMi238054383

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00002890932 – 1086Formin-like protein 2Add BLAST1085

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycine1 Publication1
Modified residuei188PhosphoserineCombined sources1

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

EPDiQ96PY5
MaxQBiQ96PY5
PaxDbiQ96PY5
PeptideAtlasiQ96PY5
PRIDEiQ96PY5
ProteomicsDBi77786
77787 [Q96PY5-3]

PTM databases

iPTMnetiQ96PY5
PhosphoSitePlusiQ96PY5

Expressioni

Gene expression databases

BgeeiENSG00000157827 Expressed in 203 organ(s), highest expression level in subthalamic nucleus
CleanExiHS_FMNL2
ExpressionAtlasiQ96PY5 baseline and differential
GenevisibleiQ96PY5 HS

Organism-specific databases

HPAiHPA005464

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi125355, 23 interactors
ELMiQ96PY5
IntActiQ96PY5, 4 interactors
MINTiQ96PY5
STRINGi9606.ENSP00000288670

Structurei

Secondary structure

11086
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ96PY5
SMRiQ96PY5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 469GBD/FH3PROSITE-ProRule annotationAdd BLAST447
Domaini616 – 1007FH2PROSITE-ProRule annotationAdd BLAST392
Domaini1040 – 1079DADPROSITE-ProRule annotationAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi525 – 603Pro-richAdd BLAST79

Domaini

The DAD domain regulates activation via by an autoinhibitory interaction with the GBD/FH3 domain. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments (By similarity).By similarity

Sequence similaritiesi

Belongs to the formin homology family.Curated

Phylogenomic databases

eggNOGiKOG1923 Eukaryota
ENOG410Y3DT LUCA
GeneTreeiENSGT00760000118986
HOGENOMiHOG000231209
HOVERGENiHBG053118
InParanoidiQ96PY5
OMAiMMPGFSP
OrthoDBiEOG091G01GP
PhylomeDBiQ96PY5
TreeFamiTF325155

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR010472 FH3_dom
IPR027656 FMNL2
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd
PANTHERiPTHR23213:SF180 PTHR23213:SF180, 1 hit
PfamiView protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit
SMARTiView protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96PY5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNAGSMDSQ QTDFRAHNVP LKLPMPEPGE LEERFAIVLN AMNLPPDKAR
60 70 80 90 100
LLRQYDNEKK WELICDQERF QVKNPPHTYI QKLKGYLDPA VTRKKFRRRV
110 120 130 140 150
QESTQVLREL EISLRTNHIG WVREFLNEEN KGLDVLVEYL SFAQYAVTFD
160 170 180 190 200
FESVESTVES SVDKSKPWSR SIEDLHRGSN LPSPVGNSVS RSGRHSALRY
210 220 230 240 250
NTLPSRRTLK NSRLVSKKDD VHVCIMCLRA IMNYQYGFNM VMSHPHAVNE
260 270 280 290 300
IALSLNNKNP RTKALVLELL AAVCLVRGGH EIILSAFDNF KEVCGEKQRF
310 320 330 340 350
EKLMEHFRNE DNNIDFMVAS MQFINIVVHS VEDMNFRVHL QYEFTKLGLD
360 370 380 390 400
EYLDKLKHTE SDKLQVQIQA YLDNVFDVGA LLEDAETKNA ALERVEELEE
410 420 430 440 450
NISHLSEKLQ DTENEAMSKI VELEKQLMQR NKELDVVREI YKDANTQVHT
460 470 480 490 500
LRKMVKEKEE AIQRQSTLEK KIHELEKQGT IKIQKKGDGD IAILPVVASG
510 520 530 540 550
TLSMGSEVVA GNSVGPTMGA ASSGPLPPPP PPLPPSSDTP ETVQNGPVTP
560 570 580 590 600
PMPPPPPPPP PPPPPPPPPP PPPLPGPAAE TVPAPPLAPP LPSAPPLPGT
610 620 630 640 650
SSPTVVFNSG LAAVKIKKPI KTKFRMPVFN WVALKPNQIN GTVFNEIDDE
660 670 680 690 700
RILEDLNVDE FEEIFKTKAQ GPAIDLSSSK QKIPQKGSNK VTLLEANRAK
710 720 730 740 750
NLAITLRKAG KTADEICKAI HVFDLKTLPV DFVECLMRFL PTENEVKVLR
760 770 780 790 800
LYERERKPLE NLSDEDRFMM QFSKIERLMQ KMTIMAFIGN FAESIQMLTP
810 820 830 840 850
QLHAIIAASV SIKSSQKLKK ILEIILALGN YMNSSKRGAV YGFKLQSLDL
860 870 880 890 900
LLDTKSTDRK QTLLHYISNV VKEKYHQVSL FYNELHYVEK AAAVSLENVL
910 920 930 940 950
LDVKELQRGM DLTKREYTMH DHNTLLKEFI LNNEGKLKKL QDDAKIAQDA
960 970 980 990 1000
FDDVVKYFGE NPKTTPPSVF FPVFVRFVKA YKQAEEENEL RKKQEQALME
1010 1020 1030 1040 1050
KLLEQEALME QQDPKSPSHK SKRQQQELIA ELRRRQVKDN RHVYEGKDGA
1060 1070 1080
IEDIITVLKT VPFTARTAKR GSRFFCEPVL TEEYHY
Note: No experimental confirmation available.
Length:1,086
Mass (Da):123,321
Last modified:May 26, 2009 - v3
Checksum:i951ED0A26232F640
GO
Isoform 2 (identifier: Q96PY5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1057-1086: VLKTVPFTARTAKRGSRFFCEPVLTEEYHY → DLRNQPYRRADAVRRSVRRRFDDQNLRSVNGAEITM

Show »
Length:1,092
Mass (Da):124,107
Checksum:iA20AA3D76733A717
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9IZY8C9IZY8_HUMAN
Formin-like protein 2
FMNL2
461Annotation score:

Sequence cautioni

The sequence AAI13879 differs from that shown. Aberrant splicing.Curated
The sequence AAI14439 differs from that shown. Aberrant splicing.Curated
The sequence AAX88959 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAB67795 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti570P → PP in BAB67795 (PubMed:11572484).Curated1
Sequence conflicti570P → PP in AAI67159 (PubMed:15489334).Curated1
Sequence conflicti570P → PP in CAD39058 (PubMed:17974005).Curated1
Sequence conflicti579A → S in BAB67795 (PubMed:11572484).Curated1
Sequence conflicti579A → S in AAI67159 (PubMed:15489334).Curated1
Sequence conflicti964T → R in CAD39058 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032570352Y → C. Corresponds to variant dbSNP:rs34119671Ensembl.1
Natural variantiVAR_032571504M → T. Corresponds to variant dbSNP:rs11897929Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0258871057 – 1086VLKTV…EEYHY → DLRNQPYRRADAVRRSVRRR FDDQNLRSVNGAEITM in isoform 2. 3 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067489 mRNA Translation: BAB67795.1 Different initiation.
AC012066 Genomic DNA No translation available.
AC012443 Genomic DNA Translation: AAX88959.1 Sequence problems.
AC093794 Genomic DNA No translation available.
BC113878 mRNA Translation: AAI13879.1 Sequence problems.
BC114438 mRNA Translation: AAI14439.1 Sequence problems.
BC167159 mRNA Translation: AAI67159.1
AL834396 mRNA Translation: CAD39058.1
CCDSiCCDS46429.1 [Q96PY5-3]
RefSeqiNP_443137.2, NM_052905.3 [Q96PY5-3]
UniGeneiHs.654630

Genome annotation databases

EnsembliENST00000288670; ENSP00000288670; ENSG00000157827 [Q96PY5-3]
GeneIDi114793
KEGGihsa:114793
UCSCiuc002tye.3 human [Q96PY5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067489 mRNA Translation: BAB67795.1 Different initiation.
AC012066 Genomic DNA No translation available.
AC012443 Genomic DNA Translation: AAX88959.1 Sequence problems.
AC093794 Genomic DNA No translation available.
BC113878 mRNA Translation: AAI13879.1 Sequence problems.
BC114438 mRNA Translation: AAI14439.1 Sequence problems.
BC167159 mRNA Translation: AAI67159.1
AL834396 mRNA Translation: CAD39058.1
CCDSiCCDS46429.1 [Q96PY5-3]
RefSeqiNP_443137.2, NM_052905.3 [Q96PY5-3]
UniGeneiHs.654630

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4YC7X-ray2.50B1-379[»]
ProteinModelPortaliQ96PY5
SMRiQ96PY5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125355, 23 interactors
ELMiQ96PY5
IntActiQ96PY5, 4 interactors
MINTiQ96PY5
STRINGi9606.ENSP00000288670

PTM databases

iPTMnetiQ96PY5
PhosphoSitePlusiQ96PY5

Polymorphism and mutation databases

BioMutaiFMNL2
DMDMi238054383

Proteomic databases

EPDiQ96PY5
MaxQBiQ96PY5
PaxDbiQ96PY5
PeptideAtlasiQ96PY5
PRIDEiQ96PY5
ProteomicsDBi77786
77787 [Q96PY5-3]

Protocols and materials databases

DNASUi114793
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288670; ENSP00000288670; ENSG00000157827 [Q96PY5-3]
GeneIDi114793
KEGGihsa:114793
UCSCiuc002tye.3 human [Q96PY5-1]

Organism-specific databases

CTDi114793
DisGeNETi114793
EuPathDBiHostDB:ENSG00000157827.19
GeneCardsiFMNL2
HGNCiHGNC:18267 FMNL2
HPAiHPA005464
MIMi616285 gene
neXtProtiNX_Q96PY5
OpenTargetsiENSG00000157827
PharmGKBiPA28144
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1923 Eukaryota
ENOG410Y3DT LUCA
GeneTreeiENSGT00760000118986
HOGENOMiHOG000231209
HOVERGENiHBG053118
InParanoidiQ96PY5
OMAiMMPGFSP
OrthoDBiEOG091G01GP
PhylomeDBiQ96PY5
TreeFamiTF325155

Enzyme and pathway databases

ReactomeiR-HSA-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRSiFMNL2 human
GeneWikiiFMNL2
GenomeRNAii114793
PROiPR:Q96PY5
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000157827 Expressed in 203 organ(s), highest expression level in subthalamic nucleus
CleanExiHS_FMNL2
ExpressionAtlasiQ96PY5 baseline and differential
GenevisibleiQ96PY5 HS

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR014767 DAD_dom
IPR015425 FH2_Formin
IPR010472 FH3_dom
IPR027656 FMNL2
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd
PANTHERiPTHR23213:SF180 PTHR23213:SF180, 1 hit
PfamiView protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit
SMARTiView protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS51231 DAD, 1 hit
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFMNL2_HUMAN
AccessioniPrimary (citable) accession number: Q96PY5
Secondary accession number(s): B2RZH5
, Q14CC9, Q4ZG52, Q8N3E0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 26, 2009
Last modified: November 7, 2018
This is version 135 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again