Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (11 Dec 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Outer dense fiber protein 3

Gene

ODF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Outer dense fibers are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail. May help to maintain the passive elastic structures and elastic recoil of the sperm tail.

Miscellaneous

'Shippo' is a Japanese word for tail.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Outer dense fiber protein 3
Alternative name(s):
Outer dense fiber of sperm tails protein 3
Sperm tail protein SHIPPO 1
Transcript induced in spermiogenesis protein 50
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ODF3
Synonyms:SHIPPO1, TISP50
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000177947.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19905 ODF3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608356 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96PU9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
113746

Open Targets

More...
OpenTargetsi
ENSG00000177947

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134952791

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96PU9 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ODF3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74717117

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002994641 – 254Outer dense fiber protein 3Add BLAST254

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96PU9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96PU9

PeptideAtlas

More...
PeptideAtlasi
Q96PU9

PRoteomics IDEntifications database

More...
PRIDEi
Q96PU9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
7234
77767 [Q96PU9-1]
77768 [Q96PU9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96PU9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96PU9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis-specific.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000177947 Expressed in 73 organ(s), highest expression level in epithelium of mammary gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96PU9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96PU9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA038919
HPA039241

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125258, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q96PU9, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000325868

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96PU9 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati180 – 205STPGR 1Add BLAST26
Repeati216 – 241STPGR 2Add BLAST26

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ODF3 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVHB Eukaryota
ENOG410YZ5M LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156191

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000090412

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96PU9

Identification of Orthologs from Complete Genome Data

More...
OMAi
AYRQTDM

Database of Orthologous Groups

More...
OrthoDBi
920847at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96PU9

TreeFam database of animal gene trees

More...
TreeFami
TF325804

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR010736 SHIPPO-rpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07004 SHIPPO-rpt, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96PU9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTEEVWMGTW RPHRPRGPIM ALYSSPGPKY LIPPTTGFMK HTPTKLRAPA
60 70 80 90 100
YSFRGAPMLL AENCSPGPRY NVNPKILRTG KDLGPAYSIL GRYQTKTMLT
110 120 130 140 150
PGPGDYFPEK STKYVFDSAP SHSISARTKA FRVDSTPGPA AYMLPMVMGP
160 170 180 190 200
NTVGKASQPS FSIKGRSKLG GFSDDLHKTP GPAAYRQTDV RVTKFKAPQY
210 220 230 240 250
TMAARVEPPG DKTLKPGPGA HSPEKVTLTK PCAPVVTFGI KHSDYMTPLL

VDVE
Length:254
Mass (Da):27,710
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i549AA2DEA35201E5
GO
Isoform 2 (identifier: Q96PU9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     104-138: GDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPG → ALKSAFPSWTPRDPTWSPPVLEPRGPTPRMLGSPP
     139-254: Missing.

Show »
Length:138
Mass (Da):15,296
Checksum:iAE324753BD2EA4B1
GO
Isoform 3 (identifier: Q96PU9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-224: Missing.

Show »
Length:207
Mass (Da):22,679
Checksum:iCD8081120CE24096
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W6Z3F8W6Z3_HUMAN
Outer dense fiber protein 3
ODF3
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_027686104 – 138GDYFP…DSTPG → ALKSAFPSWTPRDPTWSPPV LEPRGPTPRMLGSPP in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_027687139 – 254Missing in isoform 2. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_054893178 – 224Missing in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB067774 mRNA Translation: BAB70734.1
AY713299 mRNA Translation: AAW83203.1
AL133658 mRNA Translation: CAH10709.1
AC069287 Genomic DNA No translation available.
BC126222 mRNA Translation: AAI26223.1
BC126248 mRNA Translation: AAI26249.1
BC144022 mRNA Translation: AAI44023.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS65981.1 [Q96PU9-3]
CCDS7688.1 [Q96PU9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001273065.1, NM_001286136.1 [Q96PU9-3]
NP_444510.2, NM_053280.4 [Q96PU9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325113; ENSP00000325868; ENSG00000177947 [Q96PU9-1]
ENST00000525282; ENSP00000436588; ENSG00000177947 [Q96PU9-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
113746

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:113746

UCSC genome browser

More...
UCSCi
uc001lob.4 human [Q96PU9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067774 mRNA Translation: BAB70734.1
AY713299 mRNA Translation: AAW83203.1
AL133658 mRNA Translation: CAH10709.1
AC069287 Genomic DNA No translation available.
BC126222 mRNA Translation: AAI26223.1
BC126248 mRNA Translation: AAI26249.1
BC144022 mRNA Translation: AAI44023.1
CCDSiCCDS65981.1 [Q96PU9-3]
CCDS7688.1 [Q96PU9-1]
RefSeqiNP_001273065.1, NM_001286136.1 [Q96PU9-3]
NP_444510.2, NM_053280.4 [Q96PU9-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi125258, 7 interactors
IntActiQ96PU9, 2 interactors
STRINGi9606.ENSP00000325868

PTM databases

iPTMnetiQ96PU9
PhosphoSitePlusiQ96PU9

Polymorphism and mutation databases

BioMutaiODF3
DMDMi74717117

Proteomic databases

MassIVEiQ96PU9
PaxDbiQ96PU9
PeptideAtlasiQ96PU9
PRIDEiQ96PU9
ProteomicsDBi7234
77767 [Q96PU9-1]
77768 [Q96PU9-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
113746

Genome annotation databases

EnsembliENST00000325113; ENSP00000325868; ENSG00000177947 [Q96PU9-1]
ENST00000525282; ENSP00000436588; ENSG00000177947 [Q96PU9-3]
GeneIDi113746
KEGGihsa:113746
UCSCiuc001lob.4 human [Q96PU9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
113746
DisGeNETi113746
EuPathDBiHostDB:ENSG00000177947.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ODF3
HGNCiHGNC:19905 ODF3
HPAiHPA038919
HPA039241
MIMi608356 gene
neXtProtiNX_Q96PU9
OpenTargetsiENSG00000177947
PharmGKBiPA134952791

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVHB Eukaryota
ENOG410YZ5M LUCA
GeneTreeiENSGT00940000156191
HOGENOMiHOG000090412
InParanoidiQ96PU9
OMAiAYRQTDM
OrthoDBi920847at2759
PhylomeDBiQ96PU9
TreeFamiTF325804

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
113746
PharosiQ96PU9 Tdark

Protein Ontology

More...
PROi
PR:Q96PU9
RNActiQ96PU9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000177947 Expressed in 73 organ(s), highest expression level in epithelium of mammary gland
ExpressionAtlasiQ96PU9 baseline and differential
GenevisibleiQ96PU9 HS

Family and domain databases

InterProiView protein in InterPro
IPR010736 SHIPPO-rpt
PfamiView protein in Pfam
PF07004 SHIPPO-rpt, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiODF3A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96PU9
Secondary accession number(s): B7ZLT0, Q69YX0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: December 1, 2001
Last modified: December 11, 2019
This is version 116 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again