Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (18 Sep 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Noelin-3

Gene

OLFM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Noelin-3
Alternative name(s):
Olfactomedin-3
Optimedin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:OLFM3
Synonyms:NOE3
ORF Names:UNQ1924/PRO4399
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17990 OLFM3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607567 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96PB7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Secreted, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
118427

Open Targets

More...
OpenTargetsi
ENSG00000118733

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31917

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
OLFM3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20139068

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002008024 – 478Noelin-3Add BLAST455

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi95N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi179N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi219 ↔ 401PROSITE-ProRule annotation
Glycosylationi299N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi465N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96PB7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96PB7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96PB7

PeptideAtlas

More...
PeptideAtlasi
Q96PB7

PRoteomics IDEntifications database

More...
PRIDEi
Q96PB7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77652 [Q96PB7-1]
77653 [Q96PB7-2]
77654 [Q96PB7-3]
77655 [Q96PB7-4]
77656 [Q96PB7-5]
77657 [Q96PB7-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96PB7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96PB7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000118733 Expressed in 85 organ(s), highest expression level in endothelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96PB7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96PB7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA050297

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM3. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Homodimer.

Interacts with MYOC (By similarity).

Interacts with OLFM2 (PubMed:21228389).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125601, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q96PB7, 12 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000345192

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96PB7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini218 – 470Olfactomedin-likePROSITE-ProRule annotationAdd BLAST253

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili77 – 217Sequence analysisAdd BLAST141

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410INP6 Eukaryota
ENOG410ZVS0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156998

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000232069

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96PB7

Identification of Orthologs from Complete Genome Data

More...
OMAi
VMKSWNT

Database of Orthologous Groups

More...
OrthoDBi
421994at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96PB7

TreeFam database of animal gene trees

More...
TreeFami
TF315964

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031216 Noelin-3
IPR022082 Noelin_dom
IPR003112 Olfac-like_dom
IPR011044 Quino_amine_DH_bsu

The PANTHER Classification System

More...
PANTHERi
PTHR23192:SF36 PTHR23192:SF36, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12308 Noelin-1, 1 hit
PF02191 OLF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00284 OLF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50969 SSF50969, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51132 OLF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96PB7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPPLLKLGA VLSTMAMISN WMSQTLPSLV GLNTTRLSTP DTLTQISPKE
60 70 80 90 100
GWQVYSSAQD PDGRCICTVV APEQNLCSRD AKSRQLRQLL EKVQNMSQSI
110 120 130 140 150
EVLNLRTQRD FQYVLKMETQ MKGLKAKFRQ IEDDRKTLMT KHFQELKEKM
160 170 180 190 200
DELLPLIPVL EQYKTDAKLI TQFKEEIRNL SAVLTGIQEE IGAYDYEELH
210 220 230 240 250
QRVLSLETRL RDCMKKLTCG KLMKITGPVT VKTSGTRFGA WMTDPLASEK
260 270 280 290 300
NNRVWYMDSY TNNKIVREYK SIADFVSGAE SRTYNLPFKW AGTNHVVYNG
310 320 330 340 350
SLYFNKYQSN IIIKYSFDMG RVLAQRSLEY AGFHNVYPYT WGGFSDIDLM
360 370 380 390 400
ADEIGLWAVY ATNQNAGNIV ISQLNQDTLE VMKSWSTGYP KRSAGESFMI
410 420 430 440 450
CGTLYVTNSH LTGAKVYYSY STKTSTYEYT DIPFHNQYFH ISMLDYNARD
460 470
RALYAWNNGH QVLFNVTLFH IIKTEDDT
Length:478
Mass (Da):54,930
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i02EAAF58741489E5
GO
Isoform 2 (identifier: Q96PB7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA
     236-478: Missing.

Show »
Length:235
Mass (Da):27,218
Checksum:iB27366B01FB042F5
GO
Isoform 3 (identifier: Q96PB7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTL → MQATSNLLNLLLLSLFAGLDPSK

Show »
Length:458
Mass (Da):52,801
Checksum:i0A7C25D9E84755FC
GO
Isoform 4 (identifier: Q96PB7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTL → MQATSNLLNLLLLSLFAGLDPSK
     218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA
     236-478: Missing.

Show »
Length:215
Mass (Da):25,089
Checksum:i5B898299AFC1837E
GO
Isoform 5 (identifier: Q96PB7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:383
Mass (Da):44,502
Checksum:i895CD21DBC660834
GO
Isoform 6 (identifier: Q96PB7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.
     218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA
     236-478: Missing.

Show »
Length:140
Mass (Da):16,790
Checksum:i504964995B04DF3C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti88Q → K in AAH22531 (PubMed:15489334).Curated1
Sequence conflicti454Y → C in AAH22531 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0037701 – 95Missing in isoform 5 and isoform 6. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_0037691 – 43MSPPL…TPDTL → MQATSNLLNLLLLSLFAGLD PSK in isoform 3 and isoform 4. 2 PublicationsAdd BLAST43
Alternative sequenceiVSP_003771218 – 235TCGKL…VKTSG → IDLKKRKEEEKRQQKGEA in isoform 2, isoform 4 and isoform 6. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_003772236 – 478Missing in isoform 2, isoform 4 and isoform 6. 1 PublicationAdd BLAST243

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF397392 mRNA Translation: AAK97473.1
AF397393 mRNA Translation: AAK97474.1
AF397394 mRNA Translation: AAK97475.1
AF397395 mRNA Translation: AAK97476.1
AF397396 mRNA Translation: AAK97477.1
AF397397 mRNA Translation: AAK97478.1
AY358722 mRNA Translation: AAQ89084.1
AK095724 mRNA Translation: BAG53115.1
AL356280 Genomic DNA No translation available.
AL359760 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72922.1
BC022531 mRNA Translation: AAH22531.1
BK001429 Genomic DNA Translation: DAA01551.1
BK001429 Genomic DNA Translation: DAA01553.1
BK001429 Genomic DNA Translation: DAA01554.1
BK001429 Genomic DNA Translation: DAA01555.1
BK001429 Genomic DNA Translation: DAA01556.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30781.1 [Q96PB7-3]
CCDS72832.1 [Q96PB7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001275750.1, NM_001288821.1 [Q96PB7-1]
NP_001275752.1, NM_001288823.1 [Q96PB7-5]
NP_477518.2, NM_058170.3 [Q96PB7-3]
XP_016855729.1, XM_017000240.1 [Q96PB7-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338858; ENSP00000345192; ENSG00000118733 [Q96PB7-1]
ENST00000370103; ENSP00000359121; ENSG00000118733 [Q96PB7-3]
ENST00000536598; ENSP00000443471; ENSG00000118733 [Q96PB7-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
118427

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:118427

UCSC genome browser

More...
UCSCi
uc001duf.4 human [Q96PB7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF397392 mRNA Translation: AAK97473.1
AF397393 mRNA Translation: AAK97474.1
AF397394 mRNA Translation: AAK97475.1
AF397395 mRNA Translation: AAK97476.1
AF397396 mRNA Translation: AAK97477.1
AF397397 mRNA Translation: AAK97478.1
AY358722 mRNA Translation: AAQ89084.1
AK095724 mRNA Translation: BAG53115.1
AL356280 Genomic DNA No translation available.
AL359760 Genomic DNA No translation available.
CH471097 Genomic DNA Translation: EAW72922.1
BC022531 mRNA Translation: AAH22531.1
BK001429 Genomic DNA Translation: DAA01551.1
BK001429 Genomic DNA Translation: DAA01553.1
BK001429 Genomic DNA Translation: DAA01554.1
BK001429 Genomic DNA Translation: DAA01555.1
BK001429 Genomic DNA Translation: DAA01556.1
CCDSiCCDS30781.1 [Q96PB7-3]
CCDS72832.1 [Q96PB7-1]
RefSeqiNP_001275750.1, NM_001288821.1 [Q96PB7-1]
NP_001275752.1, NM_001288823.1 [Q96PB7-5]
NP_477518.2, NM_058170.3 [Q96PB7-3]
XP_016855729.1, XM_017000240.1 [Q96PB7-5]

3D structure databases

SMRiQ96PB7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi125601, 10 interactors
IntActiQ96PB7, 12 interactors
STRINGi9606.ENSP00000345192

PTM databases

iPTMnetiQ96PB7
PhosphoSitePlusiQ96PB7

Polymorphism and mutation databases

BioMutaiOLFM3
DMDMi20139068

Proteomic databases

jPOSTiQ96PB7
MassIVEiQ96PB7
PaxDbiQ96PB7
PeptideAtlasiQ96PB7
PRIDEiQ96PB7
ProteomicsDBi77652 [Q96PB7-1]
77653 [Q96PB7-2]
77654 [Q96PB7-3]
77655 [Q96PB7-4]
77656 [Q96PB7-5]
77657 [Q96PB7-6]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
118427
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338858; ENSP00000345192; ENSG00000118733 [Q96PB7-1]
ENST00000370103; ENSP00000359121; ENSG00000118733 [Q96PB7-3]
ENST00000536598; ENSP00000443471; ENSG00000118733 [Q96PB7-6]
GeneIDi118427
KEGGihsa:118427
UCSCiuc001duf.4 human [Q96PB7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
118427
DisGeNETi118427

GeneCards: human genes, protein and diseases

More...
GeneCardsi
OLFM3
HGNCiHGNC:17990 OLFM3
HPAiHPA050297
MIMi607567 gene
neXtProtiNX_Q96PB7
OpenTargetsiENSG00000118733
PharmGKBiPA31917

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410INP6 Eukaryota
ENOG410ZVS0 LUCA
GeneTreeiENSGT00940000156998
HOGENOMiHOG000232069
InParanoidiQ96PB7
OMAiVMKSWNT
OrthoDBi421994at2759
PhylomeDBiQ96PB7
TreeFamiTF315964

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
OLFM3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
OLFM3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
118427

Pharos

More...
Pharosi
Q96PB7

Protein Ontology

More...
PROi
PR:Q96PB7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000118733 Expressed in 85 organ(s), highest expression level in endothelial cell
ExpressionAtlasiQ96PB7 baseline and differential
GenevisibleiQ96PB7 HS

Family and domain databases

InterProiView protein in InterPro
IPR031216 Noelin-3
IPR022082 Noelin_dom
IPR003112 Olfac-like_dom
IPR011044 Quino_amine_DH_bsu
PANTHERiPTHR23192:SF36 PTHR23192:SF36, 1 hit
PfamiView protein in Pfam
PF12308 Noelin-1, 1 hit
PF02191 OLF, 1 hit
SMARTiView protein in SMART
SM00284 OLF, 1 hit
SUPFAMiSSF50969 SSF50969, 1 hit
PROSITEiView protein in PROSITE
PS51132 OLF, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNOE3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96PB7
Secondary accession number(s): Q5T3V6
, Q6IMI7, Q6IMI8, Q6IMI9, Q6IMJ1, Q8TBG1, Q96PB2, Q96PB3, Q96PB4, Q96PB5, Q96PB6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: December 1, 2001
Last modified: September 18, 2019
This is version 155 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again