Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q96P16 (RPR1A_HUMAN)

Entry version 137 (07 Apr 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Regulation of nuclear pre-mRNA domain-containing protein 1A

Gene

RPRD1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD by RPAP2. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96P16

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6807505, RNA polymerase II transcribes snRNA genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Regulation of nuclear pre-mRNA domain-containing protein 1A
Alternative name(s):
Cyclin-dependent kinase inhibitor 2B-related protein
p15INK4B-related protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RPRD1A
Synonyms:P15RS
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:25560, RPRD1A

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610347, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96P16

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000141425.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi65D → A: Partial loss of binding to POLR2A CTD in vitro. 1 Publication1
Mutagenesisi106R → A: Partial loss of binding to POLR2A CTD phosphorylated at 'Ser-2' in the heptad repeats in vitro. 1 Publication1
Mutagenesisi114R → A: Partial loss of binding to POLR2A CTD in vitro. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		55197

Open Targets

More...OpenTargetsi		ENSG00000141425

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162402042

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96P16, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RPRD1A

Domain mapping of disease mutations (DMDM)

More...DMDMi		74717048

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003113442 – 312Regulation of nuclear pre-mRNA domain-containing protein 1AAdd BLAST311

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1 Publication1
Modified residuei153PhosphoserineCombined sources1
Modified residuei156PhosphoserineCombined sources1
Modified residuei285PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96P16

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96P16

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96P16

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96P16

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96P16

PeptideAtlas

More...PeptideAtlasi		Q96P16

PRoteomics IDEntifications database

More...PRIDEi		Q96P16

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		77597 [Q96P16-1]
77598 [Q96P16-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96P16

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96P16

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in cells overexpressing CDKN2B.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000141425, Expressed in primary visual cortex and 238 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96P16, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96P16, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000141425, Tissue enhanced (epididymis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

May form a heterodimer with RPRD1B (PubMed:24997600). Associates with the RNA polymerase II subunit POLR2A (via CTD phosphorylated at 'Ser-2' and 'Ser-7' of the heptad repeats) (PubMed:22231121, PubMed:24997600, PubMed:24399136).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		120494, 99 interactors

Database of interacting proteins

More...DIPi		DIP-50901N

Protein interaction database and analysis system

More...IntActi		Q96P16, 46 interactors

Molecular INTeraction database

More...MINTi		Q96P16

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000381984

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96P16, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1312
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96P16

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2 – 133CIDPROSITE-ProRule annotationAdd BLAST132

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili244 – 286Sequence analysisAdd BLAST43

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UPF0400 (RTT103) family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2669, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000183094

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_055523_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96P16

Identification of Orthologs from Complete Genome Data

More...OMAi		AQWIMFH

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96P16

TreeFam database of animal gene trees

More...TreeFami		TF320926

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.90, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006569, CID_dom
IPR032337, CREPT
IPR008942, ENTH_VHS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04818, CID, 1 hit
PF16566, CREPT, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00582, RPR, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48464, SSF48464, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51391, CID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96P16-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAFSEAALE KKLSELSNSQ QSVQTLSLWL IHHRKHSRPI VTVWERELRK 
        60         70         80         90        100
AKPNRKLTFL YLANDVIQNS KRKGPEFTKD FAPVIVEAFK HVSSETDESC 
       110        120        130        140        150
KKHLGRVLSI WEERSVYEND VLEQLKQALY GDKKPRKRTY EQIKVDENEN 
       160        170        180        190        200
CSSLGSPSEP PQTLDLVRAL QDLENAASGD AAVHQRIASL PVEVQEVSLL 
       210        220        230        240        250
DKITDKESGE RLSKMVEDAC MLLADYNGRL AAEIDDRKQL TRMLADFLRC 
       260        270        280        290        300
QKEALAEKEH KLEEYKRKLA RVSLVRKELR SRIQSLPDLS RLPNVTGSHM 
       310 
HLPFAGDIYS ED
Length:312
Mass (Da):35,720
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i61785281F31CB328
GO
Isoform 2 (identifier: Q96P16-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKA → MRNSNWRFCQTGIYS

Show »
Length:276
Mass (Da):31,625
Checksum:i09748C553C326E55
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGQ6A0A0C4DGQ6_HUMAN
Regulation of nuclear pre-mRNA doma...
RPRD1A
289Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQR8K7EQR8_HUMAN
Regulation of nuclear pre-mRNA doma...
RPRD1A
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EP82K7EP82_HUMAN
Regulation of nuclear pre-mRNA doma...
RPRD1A
123Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ER50K7ER50_HUMAN
Regulation of nuclear pre-mRNA doma...
RPRD1A
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH10136 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti193E → D in BAA91736 (PubMed:14702039).Curated1
Sequence conflicti234I → V in BAA91736 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03722921Q → H in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0295311 – 51MSAFS…ELRKA → MRNSNWRFCQTGIYS in isoform 2. 2 PublicationsAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF419845 mRNA Translation: AAL15972.1
AK001518 mRNA Translation: BAA91736.1
AK292907 mRNA Translation: BAF85596.1
AK314569 mRNA Translation: BAG37150.1
CH471088 Genomic DNA Translation: EAX01365.1
CH471088 Genomic DNA Translation: EAX01366.1
CH471088 Genomic DNA Translation: EAX01367.1
BC000225 mRNA Translation: AAH00225.2
BC010136 mRNA Translation: AAH10136.1 Sequence problems.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11917.1 [Q96P16-1]
CCDS77178.1 [Q96P16-3]

NCBI Reference Sequences

More...RefSeqi		NP_001290340.1, NM_001303411.1 [Q96P16-3]
NP_001290341.1, NM_001303412.1 [Q96P16-3]
NP_001290342.1, NM_001303413.1
NP_060640.2, NM_018170.4 [Q96P16-1]
XP_011524350.1, XM_011526048.1 [Q96P16-1]
XP_011524351.1, XM_011526049.1 [Q96P16-3]
XP_011524352.1, XM_011526050.1 [Q96P16-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000357384; ENSP00000349955; ENSG00000141425 [Q96P16-1]
ENST00000399022; ENSP00000381984; ENSG00000141425 [Q96P16-1]
ENST00000588737; ENSP00000465444; ENSG00000141425 [Q96P16-3]
ENST00000590898; ENSP00000467991; ENSG00000141425 [Q96P16-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55197

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55197

UCSC genome browser

More...UCSCi		uc002kze.2, human [Q96P16-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF419845 mRNA Translation: AAL15972.1
AK001518 mRNA Translation: BAA91736.1
AK292907 mRNA Translation: BAF85596.1
AK314569 mRNA Translation: BAG37150.1
CH471088 Genomic DNA Translation: EAX01365.1
CH471088 Genomic DNA Translation: EAX01366.1
CH471088 Genomic DNA Translation: EAX01367.1
BC000225 mRNA Translation: AAH00225.2
BC010136 mRNA Translation: AAH10136.1 Sequence problems.
CCDSiCCDS11917.1 [Q96P16-1]
CCDS77178.1 [Q96P16-3]
RefSeqiNP_001290340.1, NM_001303411.1 [Q96P16-3]
NP_001290341.1, NM_001303412.1 [Q96P16-3]
NP_001290342.1, NM_001303413.1
NP_060640.2, NM_018170.4 [Q96P16-1]
XP_011524350.1, XM_011526048.1 [Q96P16-1]
XP_011524351.1, XM_011526049.1 [Q96P16-3]
XP_011524352.1, XM_011526050.1 [Q96P16-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4JXTX-ray1.90A1-137[»]
4NACX-ray2.00A/B1-131[»]
SMRiQ96P16
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi120494, 99 interactors
DIPiDIP-50901N
IntActiQ96P16, 46 interactors
MINTiQ96P16
STRINGi9606.ENSP00000381984

PTM databases

iPTMnetiQ96P16
PhosphoSitePlusiQ96P16

Genetic variation databases

BioMutaiRPRD1A
DMDMi74717048

Proteomic databases

EPDiQ96P16
jPOSTiQ96P16
MassIVEiQ96P16
MaxQBiQ96P16
PaxDbiQ96P16
PeptideAtlasiQ96P16
PRIDEiQ96P16
ProteomicsDBi77597 [Q96P16-1]
77598 [Q96P16-3]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q96P16, 6 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		22307, 112 antibodies

The DNASU plasmid repository

More...DNASUi		55197

Genome annotation databases

EnsembliENST00000357384; ENSP00000349955; ENSG00000141425 [Q96P16-1]
ENST00000399022; ENSP00000381984; ENSG00000141425 [Q96P16-1]
ENST00000588737; ENSP00000465444; ENSG00000141425 [Q96P16-3]
ENST00000590898; ENSP00000467991; ENSG00000141425 [Q96P16-3]
GeneIDi55197
KEGGihsa:55197
UCSCiuc002kze.2, human [Q96P16-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55197
DisGeNETi55197

GeneCards: human genes, protein and diseases

More...GeneCardsi		RPRD1A
HGNCiHGNC:25560, RPRD1A
HPAiENSG00000141425, Tissue enhanced (epididymis)
MIMi610347, gene
neXtProtiNX_Q96P16
OpenTargetsiENSG00000141425
PharmGKBiPA162402042
VEuPathDBiHostDB:ENSG00000141425.17

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2669, Eukaryota
GeneTreeiENSGT00950000183094
HOGENOMiCLU_055523_1_0_1
InParanoidiQ96P16
OMAiAQWIMFH
PhylomeDBiQ96P16
TreeFamiTF320926

Enzyme and pathway databases

PathwayCommonsiQ96P16
ReactomeiR-HSA-6807505, RNA polymerase II transcribes snRNA genes

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		55197, 37 hits in 1001 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RPRD1A, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55197
PharosiQ96P16, Tbio

Protein Ontology

More...PROi		PR:Q96P16
RNActiQ96P16, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000141425, Expressed in primary visual cortex and 238 other tissues
ExpressionAtlasiQ96P16, baseline and differential
GenevisibleiQ96P16, HS

Family and domain databases

Gene3Di1.25.40.90, 1 hit
InterProiView protein in InterPro
IPR006569, CID_dom
IPR032337, CREPT
IPR008942, ENTH_VHS
PfamiView protein in Pfam
PF04818, CID, 1 hit
PF16566, CREPT, 1 hit
SMARTiView protein in SMART
SM00582, RPR, 1 hit
SUPFAMiSSF48464, SSF48464, 1 hit
PROSITEiView protein in PROSITE
PS51391, CID, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRPR1A_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96P16
Secondary accession number(s): A8KA42
, B2RBA3, Q7Z5G8, Q96FY9, Q9NVL4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: December 1, 2001
Last modified: April 7, 2021
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  2. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again