Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q96NZ9 (PRAP1_HUMAN)

Entry version 135 (23 Feb 2022)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Proline-rich acidic protein 1

Gene

PRAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Lipid-binding protein which promotes lipid absorption by facilitating MTTP-mediated lipid transfer (mainly triglycerides and phospholipids) and MTTP-mediated apoB lipoprotein assembly and secretion (By similarity).

Protects the gastrointestinal epithelium from irradiation-induced apoptosis (By similarity).

May play an important role in maintaining normal growth homeostasis in epithelial cells (PubMed:14583459).

Involved in p53/TP53-dependent cell survival after DNA damage (PubMed:23235459).

May down-regulate the expression of MAD1L1 and exert a suppressive role in mitotic spindle assembly checkpoint in hepatocellular carcinomas (PubMed:24374861).

By similarity3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandLipid-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96NZ9

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q96NZ9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Proline-rich acidic protein 1
Alternative name(s):
Epididymis tissue protein Li 178
Uterine-specific proline-rich acidic protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PRAP1
Synonyms:UPA
ORF Names:UNQ608/PRO1195
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:23304, PRAP1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		609776, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96NZ9

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000165828

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Endoplasmic reticulum, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		118471

Open Targets

More...OpenTargetsi		ENSG00000165828

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134981678

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96NZ9, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PRAP1

Domain mapping of disease mutations (DMDM)

More...DMDMi		317373269

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 20Sequence analysisAdd BLAST20
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000029941621 – 151Proline-rich acidic protein 1Add BLAST131

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96NZ9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96NZ9

PeptideAtlas

More...PeptideAtlasi		Q96NZ9

PRoteomics IDEntifications database

More...PRIDEi		Q96NZ9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		77584 [Q96NZ9-2]
77585 [Q96NZ9-3]
77586 [Q96NZ9-4]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q96NZ9, 2 sites, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96NZ9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96NZ9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in the intestinal epithelial cells (at protein level) (PubMed:32629119). Abundantly expressed in the epithelial cells of the liver, kidney and cervix. Significantly down-regulated in hepatocellular carcinoma and right colon adenocarcinoma compared with the respective adjacent normal tissues. Expressed in epididymis (at protein level).4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine (PubMed:14583459). Induced by DNA-damaging agents in a p53/TP53-dependent manner in HepG2 liver cancer cell line and HCT116 colon cancer cell line (PubMed:23235459).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000165828, Expressed in small intestine and 132 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96NZ9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96NZ9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000165828, Group enriched (intestine, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with isoform 1 and isoform 3 of MAD1L1 (PubMed:24374861).

Interacts with MTTP (By similarity).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		125610, 16 interactors

Protein interaction database and analysis system

More...IntActi		Q96NZ9, 16 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000416126

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96NZ9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni71 – 151DisorderedSequence analysisAdd BLAST81

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi101 – 127Basic and acidic residuesSequence analysisAdd BLAST27

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502TDVH, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000012626

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96NZ9

Identification of Orthologs from Complete Genome Data

More...OMAi		WVETEDI

Database of Orthologous Groups

More...OrthoDBi		1574174at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96NZ9

TreeFam database of animal gene trees

More...TreeFami		TF337049

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR027922, PRAP

The PANTHER Classification System

More...PANTHERi		PTHR37861, PTHR37861, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15314, PRAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96NZ9-1) [UniParc]FASTAAdd to basket
Also known as: PRAP

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRLLLVTSL VVVLLWEAGA VPAPKVPIKM QVKHWPSEQD PEKAWGARVV 
        60         70         80         90        100
EPPEKDDQLV VLFPVQKPKL LTTEEKPRGQ GRGPILPGTK AWMETEDTLG 
       110        120        130        140        150
HVLSPEPDHD SLYHPPPEED QGEERPRLWV MPNHQVLLGP EEDQDHIYHP 

Q
Length:151
Mass (Da):17,208
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB751EDBFD24D08CA
GO
Isoform 2 (identifier: Q96NZ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-87: Missing.
     95-151: TEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ → SRARP

Show »
Length:90
Mass (Da):10,259
Checksum:iE8C3C22D12F8E9CC
GO
Isoform 3 (identifier: Q96NZ9-3) [UniParc]FASTAAdd to basket
Also known as: PRAPV1

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: K → NR

Show »
Length:152
Mass (Da):17,350
Checksum:i026C7D3AE8C988E1
GO
Isoform 4 (identifier: Q96NZ9-4) [UniParc]FASTAAdd to basket
Also known as: PRAPV2

The sequence of this isoform differs from the canonical sequence as follows:
     79-87: Missing.

Show »
Length:142
Mass (Da):16,332
Checksum:i149282D65B6346E6
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAP97247 differs from that shown. Reason: Frameshift.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03481554E → G1 Publication1
Natural variantiVAR_03481669K → R1 Publication1
Natural variantiVAR_03481781G → S. Corresponds to variant dbSNP:rs34780987Ensembl.1
Natural variantiVAR_034818101H → R6 PublicationsCorresponds to variant dbSNP:rs4369319Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02766043K → NR in isoform 3. 1 Publication1
Alternative sequenceiVSP_02766179 – 87Missing in isoform 2 and isoform 4. 2 Publications9
Alternative sequenceiVSP_02766295 – 151TEDTL…IYHPQ → SRARP in isoform 2. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF421885 mRNA Translation: AAL16670.1
AY158074 mRNA Translation: AAN87018.1
AF123768 mRNA Translation: AAP97247.1 Frameshift.
AY358908 mRNA Translation: AAQ89267.1
GU727628 mRNA Translation: ADU87630.1
AL360181 Genomic DNA No translation available.
CH471211 Genomic DNA Translation: EAW61336.1
BC029447 mRNA Translation: AAH29447.2
BC061643 mRNA Translation: AAH61643.1
BC071872 mRNA Translation: AAH71872.1
BC093853 mRNA Translation: AAH93853.1
BC101743 mRNA Translation: AAI01744.1
BC143590 mRNA Translation: AAI43591.1
BC143592 mRNA Translation: AAI43593.1
BC143591 mRNA Translation: AAI43592.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS44498.1 [Q96NZ9-4]
CCDS7679.1 [Q96NZ9-1]

NCBI Reference Sequences

More...RefSeqi		NP_001138673.1, NM_001145201.1 [Q96NZ9-4]
NP_660203.3, NM_145202.4 [Q96NZ9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000433452; ENSP00000416126; ENSG00000165828
ENST00000463201; ENSP00000486265; ENSG00000165828 [Q96NZ9-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		118471

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:118471

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000433452.6; ENSP00000416126.2; NM_145202.5; NP_660203.3

UCSC genome browser

More...UCSCi		uc001lmp.3, human [Q96NZ9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF421885 mRNA Translation: AAL16670.1
AY158074 mRNA Translation: AAN87018.1
AF123768 mRNA Translation: AAP97247.1 Frameshift.
AY358908 mRNA Translation: AAQ89267.1
GU727628 mRNA Translation: ADU87630.1
AL360181 Genomic DNA No translation available.
CH471211 Genomic DNA Translation: EAW61336.1
BC029447 mRNA Translation: AAH29447.2
BC061643 mRNA Translation: AAH61643.1
BC071872 mRNA Translation: AAH71872.1
BC093853 mRNA Translation: AAH93853.1
BC101743 mRNA Translation: AAI01744.1
BC143590 mRNA Translation: AAI43591.1
BC143592 mRNA Translation: AAI43593.1
BC143591 mRNA Translation: AAI43592.1
CCDSiCCDS44498.1 [Q96NZ9-4]
CCDS7679.1 [Q96NZ9-1]
RefSeqiNP_001138673.1, NM_001145201.1 [Q96NZ9-4]
NP_660203.3, NM_145202.4 [Q96NZ9-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi125610, 16 interactors
IntActiQ96NZ9, 16 interactors
STRINGi9606.ENSP00000416126

PTM databases

GlyGeniQ96NZ9, 2 sites, 1 O-linked glycan (1 site)
iPTMnetiQ96NZ9
PhosphoSitePlusiQ96NZ9

Genetic variation databases

BioMutaiPRAP1
DMDMi317373269

Proteomic databases

MassIVEiQ96NZ9
PaxDbiQ96NZ9
PeptideAtlasiQ96NZ9
PRIDEiQ96NZ9
ProteomicsDBi77584 [Q96NZ9-2]
77585 [Q96NZ9-3]
77586 [Q96NZ9-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		48788, 64 antibodies from 18 providers

The DNASU plasmid repository

More...DNASUi		118471

Genome annotation databases

EnsembliENST00000433452; ENSP00000416126; ENSG00000165828
ENST00000463201; ENSP00000486265; ENSG00000165828 [Q96NZ9-4]
GeneIDi118471
KEGGihsa:118471
MANE-SelectiENST00000433452.6; ENSP00000416126.2; NM_145202.5; NP_660203.3
UCSCiuc001lmp.3, human [Q96NZ9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		118471
DisGeNETi118471

GeneCards: human genes, protein and diseases

More...GeneCardsi		PRAP1
HGNCiHGNC:23304, PRAP1
HPAiENSG00000165828, Group enriched (intestine, liver)
MIMi609776, gene
neXtProtiNX_Q96NZ9
OpenTargetsiENSG00000165828
PharmGKBiPA134981678
VEuPathDBiHostDB:ENSG00000165828

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502TDVH, Eukaryota
GeneTreeiENSGT00390000012626
InParanoidiQ96NZ9
OMAiWVETEDI
OrthoDBi1574174at2759
PhylomeDBiQ96NZ9
TreeFamiTF337049

Enzyme and pathway databases

PathwayCommonsiQ96NZ9
SignaLinkiQ96NZ9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		118471, 3 hits in 1024 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PRAP1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		118471
PharosiQ96NZ9, Tbio

Protein Ontology

More...PROi		PR:Q96NZ9
RNActiQ96NZ9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000165828, Expressed in small intestine and 132 other tissues
ExpressionAtlasiQ96NZ9, baseline and differential
GenevisibleiQ96NZ9, HS

Family and domain databases

InterProiView protein in InterPro
IPR027922, PRAP
PANTHERiPTHR37861, PTHR37861, 1 hit
PfamiView protein in Pfam
PF15314, PRAP, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRAP1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96NZ9
Secondary accession number(s): B7ZL57
, B7ZL58, E9KL31, Q5VWY4, Q7Z4X5, Q8IWR3, Q8NCS2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: January 11, 2011
Last modified: February 23, 2022
This is version 135 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again