Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96NM4 (TOX2_HUMAN)

Entry version 169 (02 Dec 2020)
Sequence version 2 (19 Oct 2002)
Previous versions | rss
Add a publicationFeedback
Protein

TOX high mobility group box family member 2

Gene

TOX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.

Caution

It is uncertain whether Met-1 or Met-52 is the initiator.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi255 – 323HMG boxPROSITE-ProRule annotationAdd BLAST69

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96NM4

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TOX high mobility group box family member 2
Alternative name(s):
Granulosa cell HMG box protein 1
Short name:
GCX-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TOX2
Synonyms:C20orf100, GCX1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000124191.17

Human Gene Nomenclature Database

More...HGNCi		HGNC:16095, TOX2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611163, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96NM4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		84969

Open Targets

More...OpenTargetsi		ENSG00000124191

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162406727

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96NM4, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TOX2

Domain mapping of disease mutations (DMDM)

More...DMDMi		24211591

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000485711 – 488TOX high mobility group box family member 2Add BLAST488

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96NM4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96NM4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96NM4

PeptideAtlas

More...PeptideAtlasi		Q96NM4

PRoteomics IDEntifications database

More...PRIDEi		Q96NM4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		15213
33713
77537 [Q96NM4-1]
77538 [Q96NM4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96NM4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96NM4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000124191, Expressed in right lung and 160 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96NM4, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96NM4, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000124191, Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124399, 27 interactors

Protein interaction database and analysis system

More...IntActi		Q96NM4, 25 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000344724

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96NM4, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96NM4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni76 – 114Required for transcriptional activationBy similarityAdd BLAST39

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi223 – 252Nuclear localization signalBy similarityAdd BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi245 – 250Poly-Lys6
Compositional biasi372 – 456Pro-richAdd BLAST85

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0381, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158764

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_030650_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96NM4

Identification of Orthologs from Complete Genome Data

More...OMAi		PPSKMIP

Database of Orthologous Groups

More...OrthoDBi		818359at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96NM4

TreeFam database of animal gene trees

More...TreeFami		TF106481

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.30.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR009071, HMG_box_dom
IPR036910, HMG_box_dom_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00505, HMG_box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00398, HMG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47095, SSF47095, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50118, HMG_BOX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96NM4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQQTRTEAVA GAFSRCLGFC GMRLGLLLLA RHWCIAGVFP QKFDGDSAYV 
        60         70         80         90        100
GMSDGNPELL STSQTYNGQS ENNEDYEIPP ITPPNLPEPS LLHLGDHEAS 
       110        120        130        140        150
YHSLCHGLTP NGLLPAYSYQ AMDLPAIMVS NMLAQDSHLL SGQLPTIQEM 
       160        170        180        190        200
VHSEVAAYDS GRPGPLLGRP AMLASHMSAL SQSQLISQMG IRSSIAHSSP 
       210        220        230        240        250
SPPGSKSATP SPSSSTQEEE SEVHFKISGE KRPSADPGKK AKNPKKKKKK 
       260        270        280        290        300
DPNEPQKPVS AYALFFRDTQ AAIKGQNPSA TFGDVSKIVA SMWDSLGEEQ 
       310        320        330        340        350
KQSSPDQGET KSTQANPPAK MLPPKQPMYA MPGLASFLTP SDLQAFRSGA 
       360        370        380        390        400
SPASLARTLG SKSLLPGLSA SPPPPPSFPL SPTLHQQLSL PPHAQGALLS 
       410        420        430        440        450
PPVSMSPAPQ PPVLPTPMAL QVQLAMSPSP PGPQDFPHIS EFPSSSGSCS 
       460        470        480 
PGPSNPTSSG DWDSSYPSGE CGISTCSLLP RDKSLYLT
Length:488
Mass (Da):51,604
Last modified:October 19, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i687FD144CF30731A
GO
Isoform 2 (identifier: Q96NM4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     302-302: Q → QAYKRKTEAAKKEYLKALAAYRASLVSK

Show »
Length:515
Mass (Da):54,645
Checksum:i5B9ED0A9228B1449
GO
Isoform 3 (identifier: Q96NM4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     302-302: Q → QAYKRKTEAAKKEYLKALAAYRASLVSK

Show »
Length:464
Mass (Da):49,112
Checksum:i07E22E3F3E8D782A
GO
Isoform 4 (identifier: Q96NM4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MQQTRTEAVAGAFSRCLGFCGMRLGLLLLARHWCIAGVFPQ → MDVRLYPSAPAVGARPGAEPAGLAHLDYYHGG
     302-302: Q → QAYKRKTEAAKKEYLKALAAYRASLVSK

Show »
Length:506
Mass (Da):53,444
Checksum:iE5B3941DAA4E8536
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q5JYD4Q5JYD4_HUMAN
TOX high mobility group box family ...
TOX2
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti372P → PP in BAF82595 (PubMed:14702039).Curated1
Sequence conflicti482D → N in BAB70860 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049560223V → A. Corresponds to variant dbSNP:rs6103584Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456451 – 51Missing in isoform 3. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0471081 – 41MQQTR…GVFPQ → MDVRLYPSAPAVGARPGAEP AGLAHLDYYHGG in isoform 4. CuratedAdd BLAST41
Alternative sequenceiVSP_002187302Q → QAYKRKTEAAKKEYLKALAA YRASLVSK in isoform 2, isoform 3 and isoform 4. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK055135 mRNA Translation: BAB70860.1
AK289906 mRNA Translation: BAF82595.1
AL034419 Genomic DNA No translation available.
AL121587 Genomic DNA No translation available.
AL035089 Genomic DNA No translation available.
AL353797 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75944.1
CH471077 Genomic DNA Translation: EAW75945.1
CH471077 Genomic DNA Translation: EAW75946.1
BC007636 mRNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS13324.1 [Q96NM4-3]
CCDS42875.1 [Q96NM4-1]
CCDS46603.1 [Q96NM4-4]

NCBI Reference Sequences

More...RefSeqi		NP_001092266.1, NM_001098796.1 [Q96NM4-3]
NP_001092267.1, NM_001098797.1 [Q96NM4-4]
NP_001092268.1, NM_001098798.1 [Q96NM4-1]
NP_116272.1, NM_032883.2 [Q96NM4-3]
XP_006723947.1, XM_006723884.1 [Q96NM4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000341197; ENSP00000344724; ENSG00000124191 [Q96NM4-4]
ENST00000358131; ENSP00000350849; ENSG00000124191 [Q96NM4-1]
ENST00000372999; ENSP00000362090; ENSG00000124191 [Q96NM4-3]
ENST00000423191; ENSP00000390278; ENSG00000124191 [Q96NM4-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84969

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84969

UCSC genome browser

More...UCSCi		uc002xle.5, human [Q96NM4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055135 mRNA Translation: BAB70860.1
AK289906 mRNA Translation: BAF82595.1
AL034419 Genomic DNA No translation available.
AL121587 Genomic DNA No translation available.
AL035089 Genomic DNA No translation available.
AL353797 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75944.1
CH471077 Genomic DNA Translation: EAW75945.1
CH471077 Genomic DNA Translation: EAW75946.1
BC007636 mRNA No translation available.
CCDSiCCDS13324.1 [Q96NM4-3]
CCDS42875.1 [Q96NM4-1]
CCDS46603.1 [Q96NM4-4]
RefSeqiNP_001092266.1, NM_001098796.1 [Q96NM4-3]
NP_001092267.1, NM_001098797.1 [Q96NM4-4]
NP_001092268.1, NM_001098798.1 [Q96NM4-1]
NP_116272.1, NM_032883.2 [Q96NM4-3]
XP_006723947.1, XM_006723884.1 [Q96NM4-2]

3D structure databases

SMRiQ96NM4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124399, 27 interactors
IntActiQ96NM4, 25 interactors
STRINGi9606.ENSP00000344724

PTM databases

iPTMnetiQ96NM4
PhosphoSitePlusiQ96NM4

Polymorphism and mutation databases

BioMutaiTOX2
DMDMi24211591

Proteomic databases

jPOSTiQ96NM4
MassIVEiQ96NM4
MaxQBiQ96NM4
PeptideAtlasiQ96NM4
PRIDEiQ96NM4
ProteomicsDBi15213
33713
77537 [Q96NM4-1]
77538 [Q96NM4-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		27319, 125 antibodies

The DNASU plasmid repository

More...DNASUi		84969

Genome annotation databases

EnsembliENST00000341197; ENSP00000344724; ENSG00000124191 [Q96NM4-4]
ENST00000358131; ENSP00000350849; ENSG00000124191 [Q96NM4-1]
ENST00000372999; ENSP00000362090; ENSG00000124191 [Q96NM4-3]
ENST00000423191; ENSP00000390278; ENSG00000124191 [Q96NM4-3]
GeneIDi84969
KEGGihsa:84969
UCSCiuc002xle.5, human [Q96NM4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84969
DisGeNETi84969
EuPathDBiHostDB:ENSG00000124191.17

GeneCards: human genes, protein and diseases

More...GeneCardsi		TOX2
HGNCiHGNC:16095, TOX2
HPAiENSG00000124191, Tissue enhanced (lymphoid)
MIMi611163, gene
neXtProtiNX_Q96NM4
OpenTargetsiENSG00000124191
PharmGKBiPA162406727

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0381, Eukaryota
GeneTreeiENSGT00940000158764
HOGENOMiCLU_030650_2_0_1
InParanoidiQ96NM4
OMAiPPSKMIP
OrthoDBi818359at2759
PhylomeDBiQ96NM4
TreeFamiTF106481

Enzyme and pathway databases

PathwayCommonsiQ96NM4

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84969, 7 hits in 863 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TOX2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84969
PharosiQ96NM4, Tbio

Protein Ontology

More...PROi		PR:Q96NM4
RNActiQ96NM4, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000124191, Expressed in right lung and 160 other tissues
ExpressionAtlasiQ96NM4, baseline and differential
GenevisibleiQ96NM4, HS

Family and domain databases

Gene3Di1.10.30.10, 1 hit
InterProiView protein in InterPro
IPR009071, HMG_box_dom
IPR036910, HMG_box_dom_sf
PfamiView protein in Pfam
PF00505, HMG_box, 1 hit
SMARTiView protein in SMART
SM00398, HMG, 1 hit
SUPFAMiSSF47095, SSF47095, 1 hit
PROSITEiView protein in PROSITE
PS50118, HMG_BOX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTOX2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96NM4
Secondary accession number(s): A8K1J1
, E1P5X0, G3XAC7, Q5TE33, Q5TE34, Q5TE35, Q96IC9, Q9BQN5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 19, 2002
Last modified: December 2, 2020
This is version 169 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again