Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 171 (22 Apr 2020)
Sequence version 2 (31 Oct 2003)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 396

Gene

ZNF396

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Isoform 1 and isoform 2 act as DNA-dependent transcriptional repressors.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri251 – 273C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri279 – 301C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri307 – 329C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • negative regulation of transcription, DNA-templated Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 396
Alternative name(s):
Zinc finger and SCAN domain-containing protein 14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF396
Synonyms:ZSCAN14
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18824 ZNF396

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609600 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96N95

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000186496

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA38697

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96N95 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF396

Domain mapping of disease mutations (DMDM)

More...
DMDMi
38258950

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000475631 – 335Zinc finger protein 396Add BLAST335

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96N95

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96N95

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96N95

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96N95

PeptideAtlas

More...
PeptideAtlasi
Q96N95

PRoteomics IDEntifications database

More...
PRIDEi
Q96N95

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
77486 [Q96N95-1]
77487 [Q96N95-2]
77488 [Q96N95-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q96N95-3 [Q96N95-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96N95

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96N95

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed strongly in liver, moderately in skeletal muscle and weakly in kidney, pancreas, spleen and prostate.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186496 Expressed in buccal mucosa cell and 143 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96N95 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96N95 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000186496 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoforms 1 and 2 can both homo- and hetero-associate.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128934, 14 interactors

Protein interaction database and analysis system

More...
IntActi
Q96N95, 16 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000302310

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96N95 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96N95

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini52 – 134SCAN boxPROSITE-ProRule annotationAdd BLAST83

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri251 – 273C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri279 – 301C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri307 – 329C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163395

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002678_49_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96N95

KEGG Orthology (KO)

More...
KOi
K09230

Identification of Orthologs from Complete Genome Data

More...
OMAi
KLAPWEI

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96N95

TreeFam database of animal gene trees

More...
TreeFami
TF338304

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07936 SCAN, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.4020.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96N95-1) [UniParc]FASTAAdd to basket
Also known as: ZNF396-fu

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAKLGKSSS LLTQTSEECN GILTEKMEEE EQTCDPDSSL HWSSSYSPET
60 70 80 90 100
FRQQFRQFGY QDSPGPHEAL SRLWELCHLW LRPEVHTKEQ ILELLVLEQF
110 120 130 140 150
LAILPKELQA WVQKHHPENG EETVTMLEDV ERELDGPKQI FFGRRKDMIA
160 170 180 190 200
EKLAPSEITE ELPSSQLMPV KKQLQGASWE LQSLRPHDED IKTTNVKSAS
210 220 230 240 250
RQKTSLGIEL HCNVSNILHM NGSQSSTYRG TYEQDGRFEK RQGNPSWKKQ
260 270 280 290 300
QKCDECGKIF SQSSALILHQ RIHSGKKPYA CDECAKAFSR SAILIQHRRT
310 320 330
HTGEKPYKCH DCGKAFSQSS NLFRHRKRHI RKKVP
Length:335
Mass (Da):38,612
Last modified:October 31, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2EC72390016E3E4F
GO
Isoform 2 (identifier: Q96N95-2) [UniParc]FASTAAdd to basket
Also known as: Truncated, ZNF396-nf

The sequence of this isoform differs from the canonical sequence as follows:
     188-210: DEDIKTTNVKSASRQKTSLGIEL → GEGAGFSSCWKVWGPSAHHTHLS
     211-335: Missing.

Show »
Length:210
Mass (Da):24,061
Checksum:i59B01660963377C1
GO
Isoform 3 (identifier: Q96N95-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-335: GEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP → DSKYEHAIAEAQKNMYFKTRLKCPRSLSGGR

Show »
Length:333
Mass (Da):38,258
Checksum:i138811B6D0533261
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7ERR8K7ERR8_HUMAN
Zinc finger protein 396
ZNF396
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EK38K7EK38_HUMAN
Zinc finger protein 396
ZNF396
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti125T → A in AAM09559 (PubMed:12801647).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057418211H → L. Corresponds to variant dbSNP:rs9963473Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_008768188 – 210DEDIK…LGIEL → GEGAGFSSCWKVWGPSAHHT HLS in isoform 2. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_006923211 – 335Missing in isoform 2. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_020993303 – 335GEKPY…RKKVP → DSKYEHAIAEAQKNMYFKTR LKCPRSLSGGR in isoform 3. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF492004 mRNA Translation: AAM09559.3
AF533251 mRNA Translation: AAM95992.1
AK055775 mRNA Translation: BAB71010.1
CH471088 Genomic DNA Translation: EAX01352.1
BC130288 mRNA Translation: AAI30289.1
BC136314 mRNA Translation: AAI36315.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11913.1 [Q96N95-3]
CCDS82246.1 [Q96N95-2]
CCDS82247.1 [Q96N95-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001309215.1, NM_001322286.1 [Q96N95-1]
NP_001309219.1, NM_001322290.1 [Q96N95-1]
NP_001309220.1, NM_001322291.1 [Q96N95-2]
NP_665699.1, NM_145756.2 [Q96N95-3]
XP_006722495.1, XM_006722432.3 [Q96N95-1]
XP_016881176.1, XM_017025687.1 [Q96N95-1]
XP_016881177.1, XM_017025688.1 [Q96N95-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000306346; ENSP00000302310; ENSG00000186496 [Q96N95-3]
ENST00000586687; ENSP00000467275; ENSG00000186496 [Q96N95-2]
ENST00000589332; ENSP00000466500; ENSG00000186496 [Q96N95-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
252884

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:252884

UCSC genome browser

More...
UCSCi
uc010xcf.1 human [Q96N95-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492004 mRNA Translation: AAM09559.3
AF533251 mRNA Translation: AAM95992.1
AK055775 mRNA Translation: BAB71010.1
CH471088 Genomic DNA Translation: EAX01352.1
BC130288 mRNA Translation: AAI30289.1
BC136314 mRNA Translation: AAI36315.1
CCDSiCCDS11913.1 [Q96N95-3]
CCDS82246.1 [Q96N95-2]
CCDS82247.1 [Q96N95-1]
RefSeqiNP_001309215.1, NM_001322286.1 [Q96N95-1]
NP_001309219.1, NM_001322290.1 [Q96N95-1]
NP_001309220.1, NM_001322291.1 [Q96N95-2]
NP_665699.1, NM_145756.2 [Q96N95-3]
XP_006722495.1, XM_006722432.3 [Q96N95-1]
XP_016881176.1, XM_017025687.1 [Q96N95-1]
XP_016881177.1, XM_017025688.1 [Q96N95-1]

3D structure databases

SMRiQ96N95
ModBaseiSearch...

Protein-protein interaction databases

BioGridi128934, 14 interactors
IntActiQ96N95, 16 interactors
STRINGi9606.ENSP00000302310

PTM databases

iPTMnetiQ96N95
PhosphoSitePlusiQ96N95

Polymorphism and mutation databases

BioMutaiZNF396
DMDMi38258950

Proteomic databases

jPOSTiQ96N95
MassIVEiQ96N95
MaxQBiQ96N95
PaxDbiQ96N95
PeptideAtlasiQ96N95
PRIDEiQ96N95
ProteomicsDBi77486 [Q96N95-1]
77487 [Q96N95-2]
77488 [Q96N95-3]
TopDownProteomicsiQ96N95-3 [Q96N95-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1833 115 antibodies

The DNASU plasmid repository

More...
DNASUi
252884

Genome annotation databases

EnsembliENST00000306346; ENSP00000302310; ENSG00000186496 [Q96N95-3]
ENST00000586687; ENSP00000467275; ENSG00000186496 [Q96N95-2]
ENST00000589332; ENSP00000466500; ENSG00000186496 [Q96N95-1]
GeneIDi252884
KEGGihsa:252884
UCSCiuc010xcf.1 human [Q96N95-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
252884

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF396
HGNCiHGNC:18824 ZNF396
HPAiENSG00000186496 Low tissue specificity
MIMi609600 gene
neXtProtiNX_Q96N95
OpenTargetsiENSG00000186496
PharmGKBiPA38697

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000163395
HOGENOMiCLU_002678_49_3_1
InParanoidiQ96N95
KOiK09230
OMAiKLAPWEI
OrthoDBi1318335at2759
PhylomeDBiQ96N95
TreeFamiTF338304

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF396 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
252884
PharosiQ96N95 Tbio

Protein Ontology

More...
PROi
PR:Q96N95
RNActiQ96N95 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186496 Expressed in buccal mucosa cell and 143 other tissues
ExpressionAtlasiQ96N95 baseline and differential
GenevisibleiQ96N95 HS

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
PF00096 zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN396_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96N95
Secondary accession number(s): A1L3V0, Q8NF98, Q8TD80
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: October 31, 2003
Last modified: April 22, 2020
This is version 171 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again