Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 155 (22 Apr 2020)
Sequence version 2 (01 May 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 641

Gene

ZNF641

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Transcriptional activator. Activates transcriptional activities of SRE and AP-1.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri264 – 286C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri372 – 394C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri400 – 422C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 641
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF641
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:31834 ZNF641

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613906 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96N77

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
121274

Open Targets

More...
OpenTargetsi
ENSG00000167528

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670508

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96N77 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF641

Domain mapping of disease mutations (DMDM)

More...
DMDMi
146328571

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002853011 – 438Zinc finger protein 641Add BLAST438

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei191PhosphoserineCombined sources1
Modified residuei426PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96N77

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96N77

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96N77

PeptideAtlas

More...
PeptideAtlasi
Q96N77

PRoteomics IDEntifications database

More...
PRIDEi
Q96N77

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
3621
77481 [Q96N77-1]
77482 [Q96N77-2]
77483 [Q96N77-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96N77

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96N77

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in skeletal muscle, moderate expression in heart, liver, and pancreas, lower expression in placenta, no expression seen in brain, lung, and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167528 Expressed in blood and 206 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96N77 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96N77 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000167528 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125718, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q96N77, 7 interactors

Molecular INTeraction database

More...
MINTi
Q96N77

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000437832

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96N77 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96N77

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini109 – 181KRABPROSITE-ProRule annotationAdd BLAST73

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni171 – 265TransactivationAdd BLAST95

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri372 – 394C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri400 – 422C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162121

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002678_0_7_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96N77

KEGG Orthology (KO)

More...
KOi
K09228

Identification of Orthologs from Complete Genome Data

More...
OMAi
WESMNIQ

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96N77

TreeFam database of animal gene trees

More...
TreeFami
TF350829

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 3 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96N77-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAEDRSQFG SAAEMLSEQT AALGTGWESM NVQLDGAEPQ VERGSQEERP
60 70 80 90 100
WRTVPGPLEH LCCDLEEEPQ SLQEKAQSAP WVPAIPQEGN TGDWEMAAAL
110 120 130 140 150
LAAGSQGLVT IKDVSLCFSQ EEWRSLDPSQ TDFYGEYVMQ ENCGIVVSLR
160 170 180 190 200
FPIPKLDMLS QLEGGEEQWV PDPQDLEERD ILRVTYTGDG SEHEGDTPEL
210 220 230 240 250
EAEPPRMLSS VSEDTVLWNP EHDESWDSMP SSSRGMLLGP PFLQEDSFSN
260 270 280 290 300
LLCSTEMDSL LRPHTCPQCG KQFVWGSHLA RHQQTHTGER PYSCLKCEKT
310 320 330 340 350
FGRRHHLIRH QKTHLHDKTS RCSECGKNFR CNSHLASHQR VHAEGKSCKG
360 370 380 390 400
QEVGESPGTR KRQRAPPVPK CHVCTECGKS FGRRHHLVRH WLTHTGEKPF
410 420 430
QCPRCEKSFG RKHHLDRHLL THQGQSPRNS WDRGTSVF
Length:438
Mass (Da):49,528
Last modified:May 1, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE3873D1A84CF395D
GO
Isoform 2 (identifier: Q96N77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.
     398-438: Missing.

Show »
Length:383
Mass (Da):43,162
Checksum:iE9E7E4F2F6B2E51E
GO
Isoform 3 (identifier: Q96N77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.
     107-150: GLVTIKDVSL...ENCGIVVSLR → VSSASLGVSCGPITAAFVLLSHQPIDELAHMIING

Show »
Length:415
Mass (Da):46,525
Checksum:iA4799AF9694624B7
GO
Isoform 4 (identifier: Q96N77-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.

Show »
Length:424
Mass (Da):48,020
Checksum:i2ABA7BEB0C3B772D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VXJ5F8VXJ5_HUMAN
Zinc finger protein 641
ZNF641
136Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VZ73F8VZ73_HUMAN
Zinc finger protein 641
ZNF641
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VZV7F8VZV7_HUMAN
Zinc finger protein 641
ZNF641
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VSM8F8VSM8_HUMAN
Zinc finger protein 641
ZNF641
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHX6H0YHX6_HUMAN
Zinc finger protein 641
ZNF641
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti26G → R in AAH18090 (PubMed:15489334).Curated1
Sequence conflicti189D → G in AAW28082 (PubMed:16343441).Curated1
Sequence conflicti189D → G in BAB71031 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032009231S → C1 PublicationCorresponds to variant dbSNP:rs17851618Ensembl.1
Natural variantiVAR_032010363Q → P1 PublicationCorresponds to variant dbSNP:rs2732481Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0248671 – 14Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_043422107 – 150GLVTI…VVSLR → VSSASLGVSCGPITAAFVLL SHQPIDELAHMIING in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_024868398 – 438Missing in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY842285 mRNA Translation: AAW28082.1
AK055857 mRNA Translation: BAB71031.1
AK092740 mRNA Translation: BAG52605.1
AK298064 mRNA Translation: BAG60357.1
AC024257 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57982.1
BC018090 mRNA Translation: AAH18090.2
AL713659 mRNA Translation: CAD28468.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53787.1 [Q96N77-3]
CCDS53788.1 [Q96N77-4]
CCDS8763.1 [Q96N77-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001166152.1, NM_001172681.1 [Q96N77-4]
NP_001166153.1, NM_001172682.1 [Q96N77-3]
NP_689533.2, NM_152320.2 [Q96N77-1]
XP_005268695.1, XM_005268638.3 [Q96N77-4]
XP_011536199.1, XM_011537897.1 [Q96N77-1]
XP_011536200.1, XM_011537898.1 [Q96N77-4]
XP_016874286.1, XM_017018797.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000301042; ENSP00000301042; ENSG00000167528 [Q96N77-1]
ENST00000448928; ENSP00000394627; ENSG00000167528 [Q96N77-3]
ENST00000544117; ENSP00000437832; ENSG00000167528 [Q96N77-1]
ENST00000547026; ENSP00000449974; ENSG00000167528 [Q96N77-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
121274

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:121274

UCSC genome browser

More...
UCSCi
uc001rrn.3 human [Q96N77-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY842285 mRNA Translation: AAW28082.1
AK055857 mRNA Translation: BAB71031.1
AK092740 mRNA Translation: BAG52605.1
AK298064 mRNA Translation: BAG60357.1
AC024257 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57982.1
BC018090 mRNA Translation: AAH18090.2
AL713659 mRNA Translation: CAD28468.1
CCDSiCCDS53787.1 [Q96N77-3]
CCDS53788.1 [Q96N77-4]
CCDS8763.1 [Q96N77-1]
RefSeqiNP_001166152.1, NM_001172681.1 [Q96N77-4]
NP_001166153.1, NM_001172682.1 [Q96N77-3]
NP_689533.2, NM_152320.2 [Q96N77-1]
XP_005268695.1, XM_005268638.3 [Q96N77-4]
XP_011536199.1, XM_011537897.1 [Q96N77-1]
XP_011536200.1, XM_011537898.1 [Q96N77-4]
XP_016874286.1, XM_017018797.1

3D structure databases

SMRiQ96N77
ModBaseiSearch...

Protein-protein interaction databases

BioGridi125718, 4 interactors
IntActiQ96N77, 7 interactors
MINTiQ96N77
STRINGi9606.ENSP00000437832

PTM databases

iPTMnetiQ96N77
PhosphoSitePlusiQ96N77

Polymorphism and mutation databases

BioMutaiZNF641
DMDMi146328571

Proteomic databases

jPOSTiQ96N77
MassIVEiQ96N77
PaxDbiQ96N77
PeptideAtlasiQ96N77
PRIDEiQ96N77
ProteomicsDBi3621
77481 [Q96N77-1]
77482 [Q96N77-2]
77483 [Q96N77-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25642 64 antibodies

Genome annotation databases

EnsembliENST00000301042; ENSP00000301042; ENSG00000167528 [Q96N77-1]
ENST00000448928; ENSP00000394627; ENSG00000167528 [Q96N77-3]
ENST00000544117; ENSP00000437832; ENSG00000167528 [Q96N77-1]
ENST00000547026; ENSP00000449974; ENSG00000167528 [Q96N77-4]
GeneIDi121274
KEGGihsa:121274
UCSCiuc001rrn.3 human [Q96N77-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
121274
DisGeNETi121274

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF641
HGNCiHGNC:31834 ZNF641
HPAiENSG00000167528 Low tissue specificity
MIMi613906 gene
neXtProtiNX_Q96N77
OpenTargetsiENSG00000167528
PharmGKBiPA142670508

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000162121
HOGENOMiCLU_002678_0_7_1
InParanoidiQ96N77
KOiK09228
OMAiWESMNIQ
OrthoDBi1318335at2759
PhylomeDBiQ96N77
TreeFamiTF350829

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF641 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
121274
PharosiQ96N77 Tdark

Protein Ontology

More...
PROi
PR:Q96N77
RNActiQ96N77 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167528 Expressed in blood and 206 other tissues
ExpressionAtlasiQ96N77 baseline and differential
GenevisibleiQ96N77 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 3 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN641_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96N77
Secondary accession number(s): B3KS43
, B4DNU5, Q8TCQ7, Q8WVE1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: April 22, 2020
This is version 155 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again