Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 641

Gene

ZNF641

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional activator. Activates transcriptional activities of SRE and AP-1.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri372 – 394C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri400 – 422C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 641
Gene namesi
Name:ZNF641
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000167528.12
HGNCiHGNC:31834 ZNF641
MIMi613906 gene
neXtProtiNX_Q96N77

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000167528
PharmGKBiPA142670508

Polymorphism and mutation databases

BioMutaiZNF641
DMDMi146328571

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002853011 – 438Zinc finger protein 641Add BLAST438

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei191PhosphoserineCombined sources1
Modified residuei426PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ96N77
PeptideAtlasiQ96N77
PRIDEiQ96N77
ProteomicsDBi77481
77482 [Q96N77-2]
77483 [Q96N77-3]

PTM databases

iPTMnetiQ96N77
PhosphoSitePlusiQ96N77

Expressioni

Tissue specificityi

Highly expressed in skeletal muscle, moderate expression in heart, liver, and pancreas, lower expression in placenta, no expression seen in brain, lung, and kidney.1 Publication

Gene expression databases

BgeeiENSG00000167528 Expressed in 207 organ(s), highest expression level in blood
CleanExiHS_ZNF641
ExpressionAtlasiQ96N77 baseline and differential
GenevisibleiQ96N77 HS

Organism-specific databases

HPAiHPA035189

Interactioni

Protein-protein interaction databases

BioGridi125718, 4 interactors
IntActiQ96N77, 7 interactors
MINTiQ96N77
STRINGi9606.ENSP00000301042

Structurei

3D structure databases

ProteinModelPortaliQ96N77
SMRiQ96N77
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini109 – 181KRABPROSITE-ProRule annotationAdd BLAST73

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni171 – 265TransactivationAdd BLAST95

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri372 – 394C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri400 – 422C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00910000144000
HOGENOMiHOG000234619
HOVERGENiHBG102979
InParanoidiQ96N77
KOiK09228
OMAiKCHVCTE
OrthoDBiEOG091G0P6J
PhylomeDBiQ96N77
TreeFamiTF350829

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q96N77-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQAEDRSQFG SAAEMLSEQT AALGTGWESM NVQLDGAEPQ VERGSQEERP
60 70 80 90 100
WRTVPGPLEH LCCDLEEEPQ SLQEKAQSAP WVPAIPQEGN TGDWEMAAAL
110 120 130 140 150
LAAGSQGLVT IKDVSLCFSQ EEWRSLDPSQ TDFYGEYVMQ ENCGIVVSLR
160 170 180 190 200
FPIPKLDMLS QLEGGEEQWV PDPQDLEERD ILRVTYTGDG SEHEGDTPEL
210 220 230 240 250
EAEPPRMLSS VSEDTVLWNP EHDESWDSMP SSSRGMLLGP PFLQEDSFSN
260 270 280 290 300
LLCSTEMDSL LRPHTCPQCG KQFVWGSHLA RHQQTHTGER PYSCLKCEKT
310 320 330 340 350
FGRRHHLIRH QKTHLHDKTS RCSECGKNFR CNSHLASHQR VHAEGKSCKG
360 370 380 390 400
QEVGESPGTR KRQRAPPVPK CHVCTECGKS FGRRHHLVRH WLTHTGEKPF
410 420 430
QCPRCEKSFG RKHHLDRHLL THQGQSPRNS WDRGTSVF
Length:438
Mass (Da):49,528
Last modified:May 1, 2007 - v2
Checksum:iE3873D1A84CF395D
GO
Isoform 2 (identifier: Q96N77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.
     398-438: Missing.

Note: No experimental confirmation available.
Show »
Length:383
Mass (Da):43,162
Checksum:iE9E7E4F2F6B2E51E
GO
Isoform 3 (identifier: Q96N77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.
     107-150: GLVTIKDVSL...ENCGIVVSLR → VSSASLGVSCGPITAAFVLLSHQPIDELAHMIING

Note: No experimental confirmation available.
Show »
Length:415
Mass (Da):46,525
Checksum:iA4799AF9694624B7
GO
Isoform 4 (identifier: Q96N77-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.

Note: No experimental confirmation available.
Show »
Length:424
Mass (Da):48,020
Checksum:i2ABA7BEB0C3B772D
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VXJ5F8VXJ5_HUMAN
Zinc finger protein 641
ZNF641
136Annotation score:
F8VZ73F8VZ73_HUMAN
Zinc finger protein 641
ZNF641
107Annotation score:
F8VSM8F8VSM8_HUMAN
Zinc finger protein 641
ZNF641
82Annotation score:
F8VZV7F8VZV7_HUMAN
Zinc finger protein 641
ZNF641
77Annotation score:
H0YHX6H0YHX6_HUMAN
Zinc finger protein 641
ZNF641
51Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26G → R in AAH18090 (PubMed:15489334).Curated1
Sequence conflicti189D → G in AAW28082 (PubMed:16343441).Curated1
Sequence conflicti189D → G in BAB71031 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032009231S → C1 PublicationCorresponds to variant dbSNP:rs17851618Ensembl.1
Natural variantiVAR_032010363Q → P1 PublicationCorresponds to variant dbSNP:rs2732481Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0248671 – 14Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_043422107 – 150GLVTI…VVSLR → VSSASLGVSCGPITAAFVLL SHQPIDELAHMIING in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_024868398 – 438Missing in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY842285 mRNA Translation: AAW28082.1
AK055857 mRNA Translation: BAB71031.1
AK092740 mRNA Translation: BAG52605.1
AK298064 mRNA Translation: BAG60357.1
AC024257 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW57982.1
BC018090 mRNA Translation: AAH18090.2
AL713659 mRNA Translation: CAD28468.1
CCDSiCCDS53787.1 [Q96N77-3]
CCDS53788.1 [Q96N77-4]
CCDS8763.1 [Q96N77-1]
RefSeqiNP_001166152.1, NM_001172681.1 [Q96N77-4]
NP_001166153.1, NM_001172682.1 [Q96N77-3]
NP_689533.2, NM_152320.2 [Q96N77-1]
XP_005268695.1, XM_005268638.3 [Q96N77-4]
XP_011536199.1, XM_011537897.1 [Q96N77-1]
XP_011536200.1, XM_011537898.1 [Q96N77-4]
XP_016874286.1, XM_017018797.1 [Q96N77-3]
UniGeneiHs.23492
Hs.729288

Genome annotation databases

EnsembliENST00000301042; ENSP00000301042; ENSG00000167528 [Q96N77-1]
ENST00000448928; ENSP00000394627; ENSG00000167528 [Q96N77-3]
ENST00000544117; ENSP00000437832; ENSG00000167528 [Q96N77-1]
ENST00000547026; ENSP00000449974; ENSG00000167528 [Q96N77-4]
GeneIDi121274
KEGGihsa:121274
UCSCiuc001rrn.3 human [Q96N77-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN641_HUMAN
AccessioniPrimary (citable) accession number: Q96N77
Secondary accession number(s): B3KS43
, B4DNU5, Q8TCQ7, Q8WVE1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: September 12, 2018
This is version 142 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again