Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urocanate hydratase

Gene

UROC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

NAD+By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: L-histidine degradation into L-glutamate

This protein is involved in step 2 of the subpathway that synthesizes N-formimidoyl-L-glutamate from L-histidine.
Proteins known to be involved in the 3 steps of the subpathway in this organism are:
  1. Histidine ammonia-lyase (hutH), Histidine ammonia-lyase (HAL)
  2. Urocanate hydratase (UROC1)
  3. Probable imidazolonepropionase (AMDHD1)
This subpathway is part of the pathway L-histidine degradation into L-glutamate, which is itself part of Amino-acid degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes N-formimidoyl-L-glutamate from L-histidine, the pathway L-histidine degradation into L-glutamate and in Amino-acid degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei204NADBy similarity1
Binding sitei271NADBy similarity1
Binding sitei403NAD; via carbonyl oxygenBy similarity1
Binding sitei594NAD; via carbonyl oxygenBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi126 – 127NADBy similarity2
Nucleotide bindingi251 – 253NADBy similarity3
Nucleotide bindingi317 – 318NADBy similarity2
Nucleotide bindingi343 – 347NADBy similarity5
Nucleotide bindingi354 – 355NADBy similarity2

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • urocanate hydratase activity Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase
Biological processHistidine metabolism
LigandNAD

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-70921 Histidine catabolism

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00379;UER00550

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Urocanate hydratase (EC:4.2.1.49)
Short name:
Urocanase
Alternative name(s):
Imidazolonepropionate hydrolase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UROC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000159650.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26444 UROC1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613012 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96N76

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Urocanase deficiency (UROCD)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn inborn error of histidine metabolism resulting in urocanic aciduria and neurological manifestations including mental retardation, ataxia, episodic aggressive behavior or exaggerated affection-seeking.
See also OMIM:276880
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06264970L → P in UROCD. 1 PublicationCorresponds to variant dbSNP:rs137852796EnsemblClinVar.1
Natural variantiVAR_060221450R → C in UROCD; loss of activity. 1 PublicationCorresponds to variant dbSNP:rs137852795Ensembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
131669

MalaCards human disease database

More...
MalaCardsi
UROC1
MIMi276880 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000159650

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
210128 Urocanic aciduria

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134879207

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UROC1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
22256789

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002073741 – 676Urocanate hydrataseAdd BLAST676

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96N76

PeptideAtlas

More...
PeptideAtlasi
Q96N76

PRoteomics IDEntifications database

More...
PRIDEi
Q96N76

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77480

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96N76

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96N76

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000159650 Expressed in 21 organ(s), highest expression level in liver

CleanEx database of gene expression profiles

More...
CleanExi
HS_UROC1

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96N76 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA069863

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q96N76, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000373073

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q96N76

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96N76

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the urocanase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEG2 Eukaryota
COG2987 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015136

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000237607

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG031614

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96N76

KEGG Orthology (KO)

More...
KOi
K01712

Identification of Orthologs from Complete Genome Data

More...
OMAi
VSFHHGG

Database of Orthologous Groups

More...
OrthoDBi
EOG091G05SA

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96N76

TreeFam database of animal gene trees

More...
TreeFami
TF314306

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.10730, 1 hit

HAMAP database of protein families

More...
HAMAPi
MF_00577 HutU, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR023637 Urocanase
IPR035401 Urocanase_C
IPR038364 Urocanase_central_sf
IPR023636 Urocanase_CS
IPR035400 Urocanase_N
IPR035085 Urocanase_Rossmann-like
IPR036190 Urocanase_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12216 PTHR12216, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01175 Urocanase, 1 hit
PF17392 Urocanase_C, 1 hit
PF17391 Urocanase_N, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF001423 Urocanate_hydrat, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111326 SSF111326, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01233 UROCANASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96N76-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSLQALCSG LPLRPLPENR GRQAGVPHAP VRTPSLSPVE KQLALRNALR
60 70 80 90 100
YFPPDVQELL APEFAQELQL YGHIYMYRFC PDIEMRAYPI EQYPCQTKVA
110 120 130 140 150
AAIMHMIMNN LDPAVAQFPQ ELVTYGGNGQ VFSNWAQFWL TMFYLSKMTE
160 170 180 190 200
EQTLVMYSGH PLGLFPSSRS APRLVITNGM VIPNYSSRTE YEKLFALGVT
210 220 230 240 250
MYGQMTAGSY CYIGPQGIVH GTVLTVLNAA RRYLGIEDLA GKVFVTSGLG
260 270 280 290 300
GMSGAQAKAA VIVGCIGVIA EVDKAALEKR HRQGWLMEVT DSLDRCIQRL
310 320 330 340 350
REARKKKEVL SLGYHGNVVA LWERLVHELD TTGECLVDLG SDQTSCHNPF
360 370 380 390 400
NGGYYPVQLS FTEAQSLMAS NPAVFKDLVQ ESLRRQVSAI NRLAEEKFFF
410 420 430 440 450
WDYGNAFLLE AQRAGADVEK KGAGRTEFRY PSYVQHIMGD IFSQGFGPFR
460 470 480 490 500
WVCTSGDPQD LAVTDELATS VLEEAIADGV KVSVKLQYMD NIRWIREAAR
510 520 530 540 550
HRLVVGSQAR ILYSDQKGRV AIAVAINQAI ACRRIKAPVV LSRDHHDVSG
560 570 580 590 600
TDSPFRETSN IYDGSAFCAD MAVQNFVGDA CRGATWVALH NGGGVGWGEV
610 620 630 640 650
INGGFGLVLD GTPEAEGRAR LMLSWDVSNG VARRCWSGNQ KAYEIICQTM
660 670
QENSTLVVTL PHKVEDERVL QQALQL
Length:676
Mass (Da):74,831
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC940D3D068648D17
GO
Isoform 2 (identifier: Q96N76-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     300-300: L → LRVLQLGLQQALGWAGLPAALGLCVLSCFVNLAPLGEGRCLAPSGFSRPLLGAPVLLLCPS

Note: No experimental confirmation available.
Show »
Length:736
Mass (Da):80,912
Checksum:iBADDBCB7BCB4ACA5
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD38651 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06264970L → P in UROCD. 1 PublicationCorresponds to variant dbSNP:rs137852796EnsemblClinVar.1
Natural variantiVAR_034000188R → W. Corresponds to variant dbSNP:rs34488036Ensembl.1
Natural variantiVAR_034001311S → T. Corresponds to variant dbSNP:rs35062810Ensembl.1
Natural variantiVAR_042732429R → C. Corresponds to variant dbSNP:rs9871671Ensembl.1
Natural variantiVAR_060221450R → C in UROCD; loss of activity. 1 PublicationCorresponds to variant dbSNP:rs137852795Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_045422300L → LRVLQLGLQQALGWAGLPAA LGLCVLSCFVNLAPLGEGRC LAPSGFSRPLLGAPVLLLCP S in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB075869 mRNA Translation: BAD38651.1 Different initiation.
AK055862 mRNA Translation: BAB71032.1
AC024558 Genomic DNA No translation available.
BC115405 mRNA Translation: AAI15406.1
BC115406 mRNA Translation: AAI15407.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3038.1 [Q96N76-1]
CCDS54636.1 [Q96N76-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001159446.1, NM_001165974.1 [Q96N76-2]
NP_653240.1, NM_144639.2 [Q96N76-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.331148

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000290868; ENSP00000290868; ENSG00000159650 [Q96N76-1]
ENST00000383579; ENSP00000373073; ENSG00000159650 [Q96N76-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
131669

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:131669

UCSC genome browser

More...
UCSCi
uc003eiz.3 human [Q96N76-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB075869 mRNA Translation: BAD38651.1 Different initiation.
AK055862 mRNA Translation: BAB71032.1
AC024558 Genomic DNA No translation available.
BC115405 mRNA Translation: AAI15406.1
BC115406 mRNA Translation: AAI15407.1
CCDSiCCDS3038.1 [Q96N76-1]
CCDS54636.1 [Q96N76-2]
RefSeqiNP_001159446.1, NM_001165974.1 [Q96N76-2]
NP_653240.1, NM_144639.2 [Q96N76-1]
UniGeneiHs.331148

3D structure databases

ProteinModelPortaliQ96N76
SMRiQ96N76
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ96N76, 1 interactor
STRINGi9606.ENSP00000373073

PTM databases

iPTMnetiQ96N76
PhosphoSitePlusiQ96N76

Polymorphism and mutation databases

BioMutaiUROC1
DMDMi22256789

Proteomic databases

PaxDbiQ96N76
PeptideAtlasiQ96N76
PRIDEiQ96N76
ProteomicsDBi77480

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000290868; ENSP00000290868; ENSG00000159650 [Q96N76-1]
ENST00000383579; ENSP00000373073; ENSG00000159650 [Q96N76-2]
GeneIDi131669
KEGGihsa:131669
UCSCiuc003eiz.3 human [Q96N76-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
131669
DisGeNETi131669
EuPathDBiHostDB:ENSG00000159650.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UROC1
HGNCiHGNC:26444 UROC1
HPAiHPA069863
MalaCardsiUROC1
MIMi276880 phenotype
613012 gene
neXtProtiNX_Q96N76
OpenTargetsiENSG00000159650
Orphaneti210128 Urocanic aciduria
PharmGKBiPA134879207

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IEG2 Eukaryota
COG2987 LUCA
GeneTreeiENSGT00390000015136
HOGENOMiHOG000237607
HOVERGENiHBG031614
InParanoidiQ96N76
KOiK01712
OMAiVSFHHGG
OrthoDBiEOG091G05SA
PhylomeDBiQ96N76
TreeFamiTF314306

Enzyme and pathway databases

UniPathwayi
UPA00379;UER00550

ReactomeiR-HSA-70921 Histidine catabolism

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
131669

Protein Ontology

More...
PROi
PR:Q96N76

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000159650 Expressed in 21 organ(s), highest expression level in liver
CleanExiHS_UROC1
GenevisibleiQ96N76 HS

Family and domain databases

Gene3Di3.40.50.10730, 1 hit
HAMAPiMF_00577 HutU, 1 hit
InterProiView protein in InterPro
IPR023637 Urocanase
IPR035401 Urocanase_C
IPR038364 Urocanase_central_sf
IPR023636 Urocanase_CS
IPR035400 Urocanase_N
IPR035085 Urocanase_Rossmann-like
IPR036190 Urocanase_sf
PANTHERiPTHR12216 PTHR12216, 1 hit
PfamiView protein in Pfam
PF01175 Urocanase, 1 hit
PF17392 Urocanase_C, 1 hit
PF17391 Urocanase_N, 1 hit
PIRSFiPIRSF001423 Urocanate_hydrat, 1 hit
SUPFAMiSSF111326 SSF111326, 1 hit
PROSITEiView protein in PROSITE
PS01233 UROCANASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHUTU_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96N76
Secondary accession number(s): E9PE13, Q14C64, Q68CJ7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 13, 2002
Last sequence update: December 1, 2001
Last modified: December 5, 2018
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again