Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (31 Jul 2019)
Sequence version 4 (09 Jan 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Dedicator of cytokinesis protein 7

Gene

DOCK7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. Does not have a GEF activity for CDC42. Required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization (PubMed:16982419). Has a role in pigmentation (By similarity). Involved in the regulation of cortical neurogenesis through the control of radial glial cells (RGCs) proliferation versus differentiation; negatively regulates the basal-to-apical interkinetic nuclear migration of RGCs by antagonizing the microtubule growth-promoting function of TACC3 (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Guanine-nucleotide releasing factor
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8875555 MET activates RAP1 and RAC1
R-HSA-983231 Factors involved in megakaryocyte development and platelet production

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q96N67

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dedicator of cytokinesis protein 7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DOCK7
Synonyms:KIAA1771
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19190 DOCK7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615730 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96N67

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Epileptic encephalopathy, early infantile, 23 (EIEE23)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA severe disease characterized by early-onset intractable epilepsy, dysmorphic features, intellectual disability, and cortical blindness. Brain imaging shows an abnormally marked pontobulbar sulcus with mild pontine hypoplasia, white matter abnormalities, and atrophy in the occipital lobe.
Related information in OMIM

Keywords - Diseasei

Epilepsy

Organism-specific databases

DisGeNET

More...
DisGeNETi
85440

MalaCards human disease database

More...
MalaCardsi
DOCK7
MIMi615859 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000116641

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
411986 Early-onset epileptic encephalopathy-cortical blindness-intellectual disability-facial dysmorphism syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134872825

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DOCK7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
122065170

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001899951 – 2140Dedicator of cytokinesis protein 7Add BLAST2140

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei30PhosphoserineCombined sources1
Modified residuei180PhosphoserineCombined sources1
Modified residuei182PhosphoserineCombined sources1
Modified residuei381N6-methyllysineCombined sources1
Modified residuei450PhosphothreonineBy similarity1
Modified residuei452PhosphoserineCombined sources1
Modified residuei862PhosphoserineBy similarity1
Modified residuei864PhosphoserineBy similarity1
Modified residuei882PhosphoserineCombined sources1
Modified residuei888PhosphoserineCombined sources1
Modified residuei896PhosphoserineCombined sources1
Modified residuei900PhosphoserineCombined sources1
Modified residuei905PhosphoserineCombined sources1
Modified residuei907PhosphothreonineCombined sources1
Modified residuei909PhosphothreonineCombined sources1
Modified residuei910PhosphoserineCombined sources1
Modified residuei929PhosphoserineCombined sources1
Modified residuei964PhosphoserineCombined sources1
Modified residuei1383PhosphoserineCombined sources1
Modified residuei1430PhosphoserineCombined sources1
Modified residuei1432PhosphoserineCombined sources1
Modified residuei1434PhosphoserineBy similarity1
Modified residuei1438PhosphoserineCombined sources1
Modified residuei1962N6-acetyllysineCombined sources1
Modified residuei2129PhosphoserineCombined sources1
Isoform 3 (identifier: Q96N67-3)
Modified residuei1390PhosphoserineCombined sources1
Modified residuei1394PhosphoserineCombined sources1
Modified residuei1398PhosphoserineCombined sources1
Isoform 4 (identifier: Q96N67-4)
Modified residuei1390PhosphoserineCombined sources1
Modified residuei1394PhosphoserineCombined sources1
Modified residuei1398PhosphoserineCombined sources1
Isoform 2 (identifier: Q96N67-2)
Modified residuei1421PhosphoserineCombined sources1
Modified residuei1425PhosphoserineCombined sources1
Modified residuei1429PhosphoserineCombined sources1
Isoform 6 (identifier: Q96N67-6)
Modified residuei1421PhosphoserineCombined sources1
Modified residuei1425PhosphoserineCombined sources1
Modified residuei1429PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96N67

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96N67

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96N67

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96N67

PeptideAtlas

More...
PeptideAtlasi
Q96N67

PRoteomics IDEntifications database

More...
PRIDEi
Q96N67

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77473 [Q96N67-1]
77474 [Q96N67-2]
77475 [Q96N67-3]
77476 [Q96N67-4]
77477 [Q96N67-5]
77478 [Q96N67-6]
77516

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96N67

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96N67

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000116641 Expressed in 197 organ(s), highest expression level in kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96N67 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96N67 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TSC1.

Interacts with nucleotide-free RAC1 and RAC3.

Interacts with TACC3 and CRY1 (By similarity).

Interacts with NOD2 (PubMed:27812135).

By similarity3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124527, 93 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q96N67

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q96N67

Protein interaction database and analysis system

More...
IntActi
Q96N67, 53 interactors

Molecular INTeraction database

More...
MINTi
Q96N67

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000251157

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12140
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96N67

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini561 – 727DHR-1PROSITE-ProRule annotationAdd BLAST167
Domaini1678 – 2114DHR-2PROSITE-ProRule annotationAdd BLAST437

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili365 – 395Sequence analysisAdd BLAST31
Coiled coili2086 – 2112Sequence analysisAdd BLAST27

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The DHR-2 domain mediates GEF activity.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DOCK family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1997 Eukaryota
ENOG410XNVY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155661

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000122264

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96N67

KEGG Orthology (KO)

More...
KOi
K21852

Identification of Orthologs from Complete Genome Data

More...
OMAi
VKMKEYQ

Database of Orthologous Groups

More...
OrthoDBi
20156at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96N67

TreeFam database of animal gene trees

More...
TreeFami
TF313629

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08696 C2_Dock-C, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037808 C2_Dock-C
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N

The PANTHER Classification System

More...
PANTHERi
PTHR23317 PTHR23317, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96N67-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAERRAFAQK ISRTVAAEVR KQISGQYSGS PQLLKNLNIV GNISHHTTVP
60 70 80 90 100
LTEAVDPVDL EDYLITHPLA VDSGPLRDLI EFPPDDIEVV YSPRDCRTLV
110 120 130 140 150
SAVPEESEMD PHVRDCIRSY TEDWAIVIRK YHKLGTGFNP NTLDKQKERQ
160 170 180 190 200
KGLPKQVFES DEAPDGNSYQ DDQDDLKRRS MSIDDTPRGS WACSIFDLKN
210 220 230 240 250
SLPDALLPNL LDRTPNEEID RQNDDQRKSN RHKELFALHP SPDEEEPIER
260 270 280 290 300
LSVPDIPKEH FGQRLLVKCL SLKFEIEIEP IFASLALYDV KEKKKISENF
310 320 330 340 350
YFDLNSEQMK GLLRPHVPPA AITTLARSAI FSITYPSQDV FLVIKLEKVL
360 370 380 390 400
QQGDIGECAE PYMIFKEADA TKNKEKLEKL KSQADQFCQR LGKYRMPFAW
410 420 430 440 450
TAIHLMNIVS SAGSLERDST EVEISTGERK GSWSERRNSS IVGRRSLERT
460 470 480 490 500
TSGDDACNLT SFRPATLTVT NFFKQEGDRL SDEDLYKFLA DMRRPSSVLR
510 520 530 540 550
RLRPITAQLK IDISPAPENP HYCLTPELLQ VKLYPDSRVR PTREILEFPA
560 570 580 590 600
RDVYVPNTTY RNLLYIYPQS LNFANRQGSA RNITVKVQFM YGEDPSNAMP
610 620 630 640 650
VIFGKSSCSE FSKEAYTAVV YHNRSPDFHE EIKVKLPATL TDHHHLLFTF
660 670 680 690 700
YHVSCQQKQN TPLETPVGYT WIPMLQNGRL KTGQFCLPVS LEKPPQAYSV
710 720 730 740 750
LSPEVPLPGM KWVDNHKGVF NVEVVAVSSI HTQDPYLDKF FALVNALDEH
760 770 780 790 800
LFPVRIGDMR IMENNLENEL KSSISALNSS QLEPVVRFLH LLLDKLILLV
810 820 830 840 850
IRPPVIAGQI VNLGQASFEA MASIINRLHK NLEGNHDQHG RNSLLASYIH
860 870 880 890 900
YVFRLPNTYP NSSSPGPGGL GGSVHYATMA RSAVRPASLN LNRSRSLSNS
910 920 930 940 950
NPDISGTPTS PDDEVRSIIG SKGLDRSNSW VNTGGPKAAP WGSNPSPSAE
960 970 980 990 1000
STQAMDRSCN RMSSHTETSS FLQTLTGRLP TKKLFHEELA LQWVVCSGSV
1010 1020 1030 1040 1050
RESALQQAWF FFELMVKSMV HHLYFNDKLE APRKSRFPER FMDDIAALVS
1060 1070 1080 1090 1100
TIASDIVSRF QKDTEMVERL NTSLAFFLND LLSVMDRGFV FSLIKSCYKQ
1110 1120 1130 1140 1150
VSSKLYSLPN PSVLVSLRLD FLRIICSHEH YVTLNLPCSL LTPPASPSPS
1160 1170 1180 1190 1200
VSSATSQSSG FSTNVQDQKI ANMFELSVPF RQQHYLAGLV LTELAVILDP
1210 1220 1230 1240 1250
DAEGLFGLHK KVINMVHNLL SSHDSDPRYS DPQIKARVAM LYLPLIGIIM
1260 1270 1280 1290 1300
ETVPQLYDFT ETHNQRGRPI CIATDDYESE SGSMISQTVA MAIAGTSVPQ
1310 1320 1330 1340 1350
LTRPGSFLLT STSGRQHTTF SAESSRSLLI CLLWVLKNAD ETVLQKWFTD
1360 1370 1380 1390 1400
LSVLQLNRLL DLLYLCVSCF EYKGKKVFER MNSLTFKKSK DMRAKLEEAI
1410 1420 1430 1440 1450
LGSIGARQEM VRRSRGQLGT YTIASPPERS PSGSAFGSQE NLRWRKDMTH
1460 1470 1480 1490 1500
WRQNTEKLDK SRAEIEHEAL IDGNLATEAN LIILDTLEIV VQTVSVTESK
1510 1520 1530 1540 1550
ESILGGVLKV LLHSMACNQS AVYLQHCFAT QRALVSKFPE LLFEEETEQC
1560 1570 1580 1590 1600
ADLCLRLLRH CSSSIGTIRS HASASLYLLM RQNFEIGNNF ARVKMQVTMS
1610 1620 1630 1640 1650
LSSLVGTSQN FNEEFLRRSL KTILTYAEED LELRETTFPD QVQDLVFNLH
1660 1670 1680 1690 1700
MILSDTVKMK EHQEDPEMLI DLMYRIAKGY QTSPDLRLTW LQNMAGKHSE
1710 1720 1730 1740 1750
RSNHAEAAQC LVHSAALVAE YLSMLEDRKY LPVGCVTFQN ISSNVLEESA
1760 1770 1780 1790 1800
VSDDVVSPDE EGICSGKYFT ESGLVGLLEQ AAASFSMAGM YEAVNEVYKV
1810 1820 1830 1840 1850
LIPIHEANRD AKKLSTIHGK LQEAFSKIVH QSTGWERMFG TYFRVGFYGT
1860 1870 1880 1890 1900
KFGDLDEQEF VYKEPAITKL AEISHRLEGF YGERFGEDVV EVIKDSNPVD
1910 1920 1930 1940 1950
KCKLDPNKAY IQITYVEPYF DTYEMKDRIT YFDKNYNLRR FMYCTPFTLD
1960 1970 1980 1990 2000
GRAHGELHEQ FKRKTILTTS HAFPYIKTRV NVTHKEEIIL TPIEVAIEDM
2010 2020 2030 2040 2050
QKKTQELAFA THQDPADPKM LQMVLQGSVG TTVNQGPLEV AQVFLSEIPS
2060 2070 2080 2090 2100
DPKLFRHHNK LRLCFKDFTK RCEDALRKNK SLIGPDQKEY QRELERNYHR
2110 2120 2130 2140
LKEALQPLIN RKIPQLYKAV LPVTCHRDSF SRMSLRKMDL
Length:2,140
Mass (Da):242,561
Last modified:January 9, 2007 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA14857DCB9C3AE6E
GO
Isoform 2 (identifier: Q96N67-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1419-1427: Missing.
     1832-1836: STGWE → DGK

Show »
Length:2,129
Mass (Da):241,412
Checksum:i56C741287C8296C4
GO
Isoform 3 (identifier: Q96N67-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     923-953: Missing.
     1419-1427: Missing.

Show »
Length:2,100
Mass (Da):238,534
Checksum:i4A44093C2074BD4B
GO
Isoform 4 (identifier: Q96N67-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     923-953: Missing.
     1419-1427: Missing.
     1832-1836: STGWE → DGK

Show »
Length:2,098
Mass (Da):238,274
Checksum:iA768EB92CB1CDB3D
GO
Isoform 5 (identifier: Q96N67-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     923-953: Missing.

Show »
Length:2,109
Mass (Da):239,422
Checksum:i0171AA19EEB3B57F
GO
Isoform 6 (identifier: Q96N67-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1419-1427: Missing.

Show »
Length:2,131
Mass (Da):241,673
Checksum:i2C21C8938ACE0AD5
GO
Isoform 7 (identifier: Q96N67-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     601-632: VIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEI → SPSCTHPIPTVRPLPLWCYHSIFSLLSWDFIT
     633-2140: Missing.

Note: No experimental confirmation available.
Show »
Length:632
Mass (Da):72,236
Checksum:i5CD59D3E484D8F1F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GUE9A0A1B0GUE9_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
602Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GWE0A0A1B0GWE0_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
1,229Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DGY6A0A0C4DGY6_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GVW2A0A1B0GVW2_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
443Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RRC1A0A0U1RRC1_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
248Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RR97A0A0U1RR97_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
101Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQG7A0A0U1RQG7_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQJ5A0A0U1RQJ5_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
255Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQT6A0A0U1RQT6_HUMAN
Dedicator of cytokinesis protein 7
DOCK7
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH16392 differs from that shown. Reason: Frameshift at position 1337.Curated
The sequence ABC33725 differs from that shown. Reason: Frameshift at position 911.Curated
The sequence BAB70933 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB71042 differs from that shown. Reason: Frameshift at position 1792.Curated
The sequence BAC86032 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti750H → R in BAC86032 (PubMed:14702039).Curated1
Sequence conflicti1440E → G in BAC86032 (PubMed:14702039).Curated1
Sequence conflicti1520S → N in BAB70933 (PubMed:14702039).Curated1
Sequence conflicti1521A → V in BAC86032 (PubMed:14702039).Curated1
Sequence conflicti1639P → L in BAC86032 (PubMed:14702039).Curated1
Sequence conflicti1859E → K in BAB70933 (PubMed:14702039).Curated1
Sequence conflicti1908K → T in BAB71042 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057524824I → T. Corresponds to variant dbSNP:rs35400360EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_054534601 – 632VIFGK…FHEEI → SPSCTHPIPTVRPLPLWCYH SIFSLLSWDFIT in isoform 7. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_054535633 – 2140Missing in isoform 7. 1 PublicationAdd BLAST1508
Alternative sequenceiVSP_012440923 – 953Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_0222401419 – 1427Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 4 Publications9
Alternative sequenceiVSP_0077071832 – 1836STGWE → DGK in isoform 2 and isoform 4. 4 Publications5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ341187 mRNA Translation: ABC68221.1
AK055401 mRNA Translation: BAB70917.1
AK055493 mRNA Translation: BAB70933.1 Different initiation.
AK055905 mRNA Translation: BAB71042.1 Frameshift.
AK125049 mRNA Translation: BAC86032.1 Different initiation.
AK292640 mRNA Translation: BAF85329.1
AC096946 Genomic DNA No translation available.
AC103923 Genomic DNA No translation available.
AL138847 Genomic DNA No translation available.
AL451044 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06582.1
DQ309763 mRNA Translation: ABC33725.1 Frameshift.
DQ118679 mRNA Translation: AAZ38451.1
DQ118680 mRNA Translation: AAZ38452.1
AB051558 mRNA Translation: BAB21862.1
BC016392 mRNA Translation: AAH16392.2 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30734.1 [Q96N67-5]
CCDS60156.1 [Q96N67-2]
CCDS60157.1 [Q96N67-7]
CCDS81335.1 [Q96N67-4]
CCDS81336.1 [Q96N67-3]
CCDS81338.1 [Q96N67-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001258928.1, NM_001271999.1 [Q96N67-2]
NP_001258929.1, NM_001272000.1 [Q96N67-3]
NP_001258930.1, NM_001272001.1 [Q96N67-4]
NP_001258931.1, NM_001272002.1 [Q96N67-7]
NP_001317543.1, NM_001330614.1 [Q96N67-6]
NP_212132.2, NM_033407.3 [Q96N67-5]
XP_011540628.1, XM_011542326.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000251157; ENSP00000251157; ENSG00000116641 [Q96N67-6]
ENST00000340370; ENSP00000340742; ENSG00000116641 [Q96N67-5]
ENST00000404627; ENSP00000384446; ENSG00000116641 [Q96N67-7]
ENST00000454575; ENSP00000413583; ENSG00000116641 [Q96N67-2]
ENST00000634264; ENSP00000489284; ENSG00000116641 [Q96N67-3]
ENST00000635123; ENSP00000489499; ENSG00000116641 [Q96N67-4]
ENST00000635253; ENSP00000489124; ENSG00000116641 [Q96N67-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
85440

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:85440

UCSC genome browser

More...
UCSCi
uc001dap.5 human [Q96N67-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ341187 mRNA Translation: ABC68221.1
AK055401 mRNA Translation: BAB70917.1
AK055493 mRNA Translation: BAB70933.1 Different initiation.
AK055905 mRNA Translation: BAB71042.1 Frameshift.
AK125049 mRNA Translation: BAC86032.1 Different initiation.
AK292640 mRNA Translation: BAF85329.1
AC096946 Genomic DNA No translation available.
AC103923 Genomic DNA No translation available.
AL138847 Genomic DNA No translation available.
AL451044 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX06582.1
DQ309763 mRNA Translation: ABC33725.1 Frameshift.
DQ118679 mRNA Translation: AAZ38451.1
DQ118680 mRNA Translation: AAZ38452.1
AB051558 mRNA Translation: BAB21862.1
BC016392 mRNA Translation: AAH16392.2 Frameshift.
CCDSiCCDS30734.1 [Q96N67-5]
CCDS60156.1 [Q96N67-2]
CCDS60157.1 [Q96N67-7]
CCDS81335.1 [Q96N67-4]
CCDS81336.1 [Q96N67-3]
CCDS81338.1 [Q96N67-6]
RefSeqiNP_001258928.1, NM_001271999.1 [Q96N67-2]
NP_001258929.1, NM_001272000.1 [Q96N67-3]
NP_001258930.1, NM_001272001.1 [Q96N67-4]
NP_001258931.1, NM_001272002.1 [Q96N67-7]
NP_001317543.1, NM_001330614.1 [Q96N67-6]
NP_212132.2, NM_033407.3 [Q96N67-5]
XP_011540628.1, XM_011542326.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
6AJ4X-ray3.26A/C/E/G1832-2114[»]
6AJLX-ray3.23A/C/E/G1832-2114[»]
SMRiQ96N67
ModBaseiSearch...

Protein-protein interaction databases

BioGridi124527, 93 interactors
CORUMiQ96N67
ELMiQ96N67
IntActiQ96N67, 53 interactors
MINTiQ96N67
STRINGi9606.ENSP00000251157

PTM databases

iPTMnetiQ96N67
PhosphoSitePlusiQ96N67

Polymorphism and mutation databases

BioMutaiDOCK7
DMDMi122065170

Proteomic databases

EPDiQ96N67
jPOSTiQ96N67
MaxQBiQ96N67
PaxDbiQ96N67
PeptideAtlasiQ96N67
PRIDEiQ96N67
ProteomicsDBi77473 [Q96N67-1]
77474 [Q96N67-2]
77475 [Q96N67-3]
77476 [Q96N67-4]
77477 [Q96N67-5]
77478 [Q96N67-6]
77516

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251157; ENSP00000251157; ENSG00000116641 [Q96N67-6]
ENST00000340370; ENSP00000340742; ENSG00000116641 [Q96N67-5]
ENST00000404627; ENSP00000384446; ENSG00000116641 [Q96N67-7]
ENST00000454575; ENSP00000413583; ENSG00000116641 [Q96N67-2]
ENST00000634264; ENSP00000489284; ENSG00000116641 [Q96N67-3]
ENST00000635123; ENSP00000489499; ENSG00000116641 [Q96N67-4]
ENST00000635253; ENSP00000489124; ENSG00000116641 [Q96N67-1]
GeneIDi85440
KEGGihsa:85440
UCSCiuc001dap.5 human [Q96N67-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
85440
DisGeNETi85440

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DOCK7
HGNCiHGNC:19190 DOCK7
MalaCardsiDOCK7
MIMi615730 gene
615859 phenotype
neXtProtiNX_Q96N67
OpenTargetsiENSG00000116641
Orphaneti411986 Early-onset epileptic encephalopathy-cortical blindness-intellectual disability-facial dysmorphism syndrome
PharmGKBiPA134872825

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1997 Eukaryota
ENOG410XNVY LUCA
GeneTreeiENSGT00940000155661
HOGENOMiHOG000122264
InParanoidiQ96N67
KOiK21852
OMAiVKMKEYQ
OrthoDBi20156at2759
PhylomeDBiQ96N67
TreeFamiTF313629

Enzyme and pathway databases

ReactomeiR-HSA-8875555 MET activates RAP1 and RAC1
R-HSA-983231 Factors involved in megakaryocyte development and platelet production
SIGNORiQ96N67

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DOCK7 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Dock7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
85440

Protein Ontology

More...
PROi
PR:Q96N67

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000116641 Expressed in 197 organ(s), highest expression level in kidney
ExpressionAtlasiQ96N67 baseline and differential
GenevisibleiQ96N67 HS

Family and domain databases

CDDicd08696 C2_Dock-C, 1 hit
Gene3Di2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR037808 C2_Dock-C
IPR035892 C2_domain_sf
IPR027007 DHR-1_domain
IPR027357 DHR-2
IPR026791 DOCK
IPR010703 DOCK_C
IPR021816 DOCK_C/D_N
PANTHERiPTHR23317 PTHR23317, 1 hit
PfamiView protein in Pfam
PF06920 DHR-2, 1 hit
PF14429 DOCK-C2, 1 hit
PF11878 DUF3398, 1 hit
PROSITEiView protein in PROSITE
PS51650 DHR_1, 1 hit
PS51651 DHR_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDOCK7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96N67
Secondary accession number(s): Q00M63
, Q2PPY7, Q45RE8, Q45RE9, Q5T1B9, Q5T1C0, Q6ZV32, Q8TB82, Q96NG6, Q96NI0, Q9C092
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: January 9, 2007
Last modified: July 31, 2019
This is version 160 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again