Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 108 (31 Jul 2019)
Sequence version 2 (20 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Integral membrane protein GPR137

Gene

GPR137

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Integral membrane protein GPR137
Alternative name(s):
Transmembrane 7 superfamily member 1-like 1 protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GPR137
Synonyms:C11orf4, GPR137A, TM7SF1L1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24300 GPR137

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96N19

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 31ExtracellularSequence analysisAdd BLAST31
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei32 – 52HelicalSequence analysisAdd BLAST21
Topological domaini53 – 60CytoplasmicSequence analysis8
Transmembranei61 – 81HelicalSequence analysisAdd BLAST21
Topological domaini82 – 89ExtracellularSequence analysis8
Transmembranei90 – 110HelicalSequence analysisAdd BLAST21
Topological domaini111 – 140CytoplasmicSequence analysisAdd BLAST30
Transmembranei141 – 161HelicalSequence analysisAdd BLAST21
Topological domaini162 – 175ExtracellularSequence analysisAdd BLAST14
Transmembranei176 – 196HelicalSequence analysisAdd BLAST21
Topological domaini197 – 218CytoplasmicSequence analysisAdd BLAST22
Transmembranei219 – 241HelicalSequence analysisAdd BLAST23
Topological domaini242 – 274ExtracellularSequence analysisAdd BLAST33
Transmembranei275 – 295HelicalSequence analysisAdd BLAST21
Topological domaini296 – 417CytoplasmicSequence analysisAdd BLAST122

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
56834

Open Targets

More...
OpenTargetsi
ENSG00000173264

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485482

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GPR137

Domain mapping of disease mutations (DMDM)

More...
DMDMi
126302549

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002699961 – 417Integral membrane protein GPR137Add BLAST417

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi4N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi257N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96N19

PeptideAtlas

More...
PeptideAtlasi
Q96N19

PRoteomics IDEntifications database

More...
PRIDEi
Q96N19

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77448 [Q96N19-1]
77449 [Q96N19-2]
77450 [Q96N19-3]
77451 [Q96N19-4]
77452 [Q96N19-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96N19

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96N19

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173264 Expressed in 149 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96N19 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96N19 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062871

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121207, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q96N19, 1 interactor

Molecular INTeraction database

More...
MINTi
Q96N19

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000411827

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GPR137 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGBD Eukaryota
ENOG410XQNA LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153986

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000286020

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96N19

KEGG Orthology (KO)

More...
KOi
K22989

Identification of Orthologs from Complete Genome Data

More...
OMAi
GCSWEHG

Database of Orthologous Groups

More...
OrthoDBi
1399303at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96N19

TreeFam database of animal gene trees

More...
TreeFami
TF329003

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029723 GPR137

The PANTHER Classification System

More...
PANTHERi
PTHR15146 PTHR15146, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96N19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESNLSGLVP AAGLVPALPP AVTLGLTAAY TTLYALLFFS VYAQLWLVLL
60 70 80 90 100
YGHKRLSYQT VFLALCLLWA ALRTTLFSFY FRDTPRANRL GPLPFWLLYC
110 120 130 140 150
CPVCLQFFTL TLMNLYFAQV VFKAKVKRRP EMSRGLLAVR GAFVGASLLF
160 170 180 190 200
LLVNVLCAVL SHRRRAQPWA LLLVRVLVSD SLFVICALSL AACLCLVARR
210 220 230 240 250
APSTSIYLEA KGTSVCQAAA MGGAMVLLYA SRACYNLTAL ALAPQSRLDT
260 270 280 290 300
FDYDWYNVSD QADLVNDLGN KGYLVFGLIL FVWELLPTTL LVGFFRVHRP
310 320 330 340 350
PQDLSTSHIL NGQVFASRSY FFDRAGHCED EGCSWEHSRG ESTRCQDQAA
360 370 380 390 400
TTTVSTPPHR RDPPPSPTEY PGPSPPHPRP LCQVCLPLLA QDPGGRGYPL
410
LWPAPCCSCH SELVPSP
Length:417
Mass (Da):46,059
Last modified:February 20, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4059610F4B822FCA
GO
Isoform 2 (identifier: Q96N19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

Show »
Length:396
Mass (Da):43,632
Checksum:iF95C30010101995F
GO
Isoform 3 (identifier: Q96N19-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     212-261: Missing.
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

Show »
Length:346
Mass (Da):38,256
Checksum:i597CE021C5309BD0
GO
Isoform 4 (identifier: Q96N19-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLWAVRTRCYVVKAQLGPTVALEGRAPRAPGPSCLGNGNCQRPGPITSRNVTRASLPDM

Note: No experimental confirmation available.
Show »
Length:475
Mass (Da):52,202
Checksum:iF2A08B174069042B
GO
Isoform 5 (identifier: Q96N19-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-320: STSHILNGQVFASRSY → YVGQSRLWELVWCHRA
     321-417: Missing.

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):35,756
Checksum:i6829135D1AEAF215
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H0Q1F5H0Q1_HUMAN
Integral membrane protein GPR137
GPR137
219Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXI8F5GXI8_HUMAN
Integral membrane protein GPR137
GPR137
240Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H234F5H234_HUMAN
Integral membrane protein GPR137
GPR137
225Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4R8F5H4R8_HUMAN
Integral membrane protein GPR137
GPR137
167Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1T3F5H1T3_HUMAN
Integral membrane protein GPR137
GPR137
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H1V9F5H1V9_HUMAN
Integral membrane protein GPR137
GPR137
132Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H097F5H097_HUMAN
Integral membrane protein GPR137
GPR137
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H6Y8F5H6Y8_HUMAN
Integral membrane protein GPR137
GPR137
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5GXD9F5GXD9_HUMAN
Integral membrane protein GPR137
GPR137
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7S0F5H7S0_HUMAN
Integral membrane protein GPR137
GPR137
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti254D → G in BAB71093 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0432781M → MLWAVRTRCYVVKAQLGPTV ALEGRAPRAPGPSCLGNGNC QRPGPITSRNVTRASLPDM in isoform 4. 1 Publication1
Alternative sequenceiVSP_022121212 – 261Missing in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_043592305 – 320STSHI…ASRSY → YVGQSRLWELVWCHRA in isoform 5. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_043593321 – 417Missing in isoform 5. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_022122344 – 417RCQDQ…LVPSP → SMSGSLGSGSWYGAIGREPG WYGGSQTKTTPLLFSQVPGP GGHHHSLYSTPQT in isoform 2 and isoform 3. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK056094 mRNA Translation: BAB71093.1
AK300209 mRNA Translation: BAG61979.1
AK302256 mRNA Translation: BAH13657.1
AP001453 Genomic DNA No translation available.
BC033920 mRNA Translation: AAH33920.1
BC035002 mRNA Translation: AAH35002.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS53655.1 [Q96N19-4]
CCDS53656.1 [Q96N19-2]
CCDS53657.1 [Q96N19-5]
CCDS53658.1 [Q96N19-3]
CCDS8066.1 [Q96N19-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001164197.1, NM_001170726.1 [Q96N19-4]
NP_001164351.1, NM_001170880.1 [Q96N19-2]
NP_001164352.1, NM_001170881.1 [Q96N19-3]
NP_001170829.1, NM_001177358.1 [Q96N19-5]
NP_064540.3, NM_020155.3 [Q96N19-1]
XP_005274157.1, XM_005274100.2 [Q96N19-1]
XP_005274158.1, XM_005274101.2 [Q96N19-1]
XP_005274159.1, XM_005274102.2 [Q96N19-1]
XP_005274161.1, XM_005274104.2 [Q96N19-1]
XP_011543471.1, XM_011545169.1 [Q96N19-1]
XP_016873503.1, XM_017018014.1 [Q96N19-2]
XP_016873504.1, XM_017018015.1 [Q96N19-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000313074; ENSP00000321698; ENSG00000173264 [Q96N19-1]
ENST00000377702; ENSP00000366931; ENSG00000173264 [Q96N19-3]
ENST00000411458; ENSP00000411827; ENSG00000173264 [Q96N19-4]
ENST00000438980; ENSP00000415698; ENSG00000173264 [Q96N19-2]
ENST00000539851; ENSP00000442792; ENSG00000173264 [Q96N19-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56834

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:56834

UCSC genome browser

More...
UCSCi
uc001nzf.4 human [Q96N19-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056094 mRNA Translation: BAB71093.1
AK300209 mRNA Translation: BAG61979.1
AK302256 mRNA Translation: BAH13657.1
AP001453 Genomic DNA No translation available.
BC033920 mRNA Translation: AAH33920.1
BC035002 mRNA Translation: AAH35002.1
CCDSiCCDS53655.1 [Q96N19-4]
CCDS53656.1 [Q96N19-2]
CCDS53657.1 [Q96N19-5]
CCDS53658.1 [Q96N19-3]
CCDS8066.1 [Q96N19-1]
RefSeqiNP_001164197.1, NM_001170726.1 [Q96N19-4]
NP_001164351.1, NM_001170880.1 [Q96N19-2]
NP_001164352.1, NM_001170881.1 [Q96N19-3]
NP_001170829.1, NM_001177358.1 [Q96N19-5]
NP_064540.3, NM_020155.3 [Q96N19-1]
XP_005274157.1, XM_005274100.2 [Q96N19-1]
XP_005274158.1, XM_005274101.2 [Q96N19-1]
XP_005274159.1, XM_005274102.2 [Q96N19-1]
XP_005274161.1, XM_005274104.2 [Q96N19-1]
XP_011543471.1, XM_011545169.1 [Q96N19-1]
XP_016873503.1, XM_017018014.1 [Q96N19-2]
XP_016873504.1, XM_017018015.1 [Q96N19-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi121207, 3 interactors
IntActiQ96N19, 1 interactor
MINTiQ96N19
STRINGi9606.ENSP00000411827

PTM databases

iPTMnetiQ96N19
PhosphoSitePlusiQ96N19

Polymorphism and mutation databases

BioMutaiGPR137
DMDMi126302549

Proteomic databases

PaxDbiQ96N19
PeptideAtlasiQ96N19
PRIDEiQ96N19
ProteomicsDBi77448 [Q96N19-1]
77449 [Q96N19-2]
77450 [Q96N19-3]
77451 [Q96N19-4]
77452 [Q96N19-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313074; ENSP00000321698; ENSG00000173264 [Q96N19-1]
ENST00000377702; ENSP00000366931; ENSG00000173264 [Q96N19-3]
ENST00000411458; ENSP00000411827; ENSG00000173264 [Q96N19-4]
ENST00000438980; ENSP00000415698; ENSG00000173264 [Q96N19-2]
ENST00000539851; ENSP00000442792; ENSG00000173264 [Q96N19-5]
GeneIDi56834
KEGGihsa:56834
UCSCiuc001nzf.4 human [Q96N19-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
56834
DisGeNETi56834

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GPR137
HGNCiHGNC:24300 GPR137
HPAiHPA062871
neXtProtiNX_Q96N19
OpenTargetsiENSG00000173264
PharmGKBiPA143485482

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGBD Eukaryota
ENOG410XQNA LUCA
GeneTreeiENSGT00940000153986
HOGENOMiHOG000286020
InParanoidiQ96N19
KOiK22989
OMAiGCSWEHG
OrthoDBi1399303at2759
PhylomeDBiQ96N19
TreeFamiTF329003

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GPR137 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
56834

Protein Ontology

More...
PROi
PR:Q96N19

Gene expression databases

BgeeiENSG00000173264 Expressed in 149 organ(s), highest expression level in testis
ExpressionAtlasiQ96N19 baseline and differential
GenevisibleiQ96N19 HS

Family and domain databases

InterProiView protein in InterPro
IPR029723 GPR137
PANTHERiPTHR15146 PTHR15146, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiG137A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96N19
Secondary accession number(s): B4DTG7
, B7Z7M1, Q4G0Y9, Q8N4K6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: February 20, 2007
Last modified: July 31, 2019
This is version 108 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again