Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RING finger protein 145

Gene

RNF145

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'-linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species. Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations ubiquitinates HMGCR, a rate-limiting enzyme in cholesterol biosynthesis, and targets it for degradation. The interaction with INSIG1 is required for this function. In addition, triggers ubiquitination of SCAP, likely inhibiting its transport to the Golgi apparatus and the subsequent processing/maturation of SREBPF2, ultimately downregulating cholesterol biosynthesis.By similarity

Catalytic activityi

S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N6-ubiquitinyl-[acceptor protein]-L-lysine.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei537By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri537 – 575RING-type; atypicalPROSITE-ProRule annotationAdd BLAST39

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
RING finger protein 145Curated (EC:2.3.2.27By similarity)
Gene namesi
Name:RNF145Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000145860.11
HGNCiHGNC:20853 RNF145
neXtProtiNX_Q96MT1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei53 – 73HelicalSequence analysisAdd BLAST21
Transmembranei77 – 97HelicalSequence analysisAdd BLAST21
Transmembranei123 – 143HelicalSequence analysisAdd BLAST21
Transmembranei146 – 166HelicalSequence analysisAdd BLAST21
Transmembranei168 – 188HelicalSequence analysisAdd BLAST21
Transmembranei205 – 222HelicalSequence analysisAdd BLAST18
Transmembranei225 – 245HelicalSequence analysisAdd BLAST21
Transmembranei275 – 295HelicalSequence analysisAdd BLAST21
Transmembranei316 – 336HelicalSequence analysisAdd BLAST21
Transmembranei340 – 360HelicalSequence analysisAdd BLAST21
Transmembranei384 – 404HelicalSequence analysisAdd BLAST21
Transmembranei410 – 430HelicalSequence analysisAdd BLAST21
Transmembranei460 – 480HelicalSequence analysisAdd BLAST21
Transmembranei482 – 502HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000145860
PharmGKBiPA134876286

Polymorphism and mutation databases

BioMutaiRNF145
DMDMi152060502

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002940241 – 663RING finger protein 145Add BLAST663

Proteomic databases

EPDiQ96MT1
MaxQBiQ96MT1
PaxDbiQ96MT1
PeptideAtlasiQ96MT1
PRIDEiQ96MT1
ProteomicsDBi77398
77399 [Q96MT1-2]
77400 [Q96MT1-3]
77401 [Q96MT1-4]

PTM databases

iPTMnetiQ96MT1
PhosphoSitePlusiQ96MT1

Expressioni

Gene expression databases

BgeeiENSG00000145860
CleanExiHS_RNF145
GenevisibleiQ96MT1 HS

Organism-specific databases

HPAiHPA036562

Interactioni

Subunit structurei

Interacts (via YLYF motif) with INSIG1 and INSIG2.By similarity

Protein-protein interaction databases

BioGridi127521, 1 interactor
STRINGi9606.ENSP00000430955

Structurei

3D structure databases

ProteinModelPortaliQ96MT1
SMRiQ96MT1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi81 – 84YLYF motifBy similarity4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri537 – 575RING-type; atypicalPROSITE-ProRule annotationAdd BLAST39

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG0802 Eukaryota
COG5243 LUCA
GeneTreeiENSGT00530000062938
HOGENOMiHOG000072697
HOVERGENiHBG054921
InParanoidiQ96MT1
OMAiGAEQNVM
OrthoDBiEOG091G020N
PhylomeDBiQ96MT1
TreeFamiTF318635

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR025754 TRC8_N_dom
IPR001841 Znf_RING
IPR011016 Znf_RING-CH
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF13705 TRC8_N, 1 hit
PF13639 zf-RING_2, 1 hit
SMARTiView protein in SMART
SM00184 RING, 1 hit
SM00744 RINGv, 1 hit
PROSITEiView protein in PROSITE
PS50089 ZF_RING_2, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96MT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAKEKLEAV LNVALRVPSI MLLDVLYRWD VSSFFQQIQR SSLSNNPLFQ
60 70 80 90 100
YKYLALNMHY VGYILSVVLL TLPRQHLVQL YLYFLTALLL YAGHQISRDY
110 120 130 140 150
VRSELEFAYE GPMYLEPLSM NRFTTALIGQ LVVCTLCSCV MKTKQIWLFS
160 170 180 190 200
AHMLPLLARL CLVPLETIVI INKFAMIFTG LEVLYFLGSN LLVPYNLAKS
210 220 230 240 250
AYRELVQVVE VYGLLALGMS LWNQLVVPVL FMVFWLVLFA LQIYSYFSTR
260 270 280 290 300
DQPASRERLL FLFLTSIAEC CSTPYSLLGL VFTVSFVALG VLTLCKFYLQ
310 320 330 340 350
GYRAFMNDPA MNRGMTEGVT LLILAVQTGL IELQVVHRAF LLSIILFIVV
360 370 380 390 400
ASILQSMLEI ADPIVLALGA SRDKSLWKHF RAVSLCLFLL VFPAYMAYMI
410 420 430 440 450
CQFFHMDFWL LIIISSSILT SLQVLGTLFI YVLFMVEEFR KEPVENMDDV
460 470 480 490 500
IYYVNGTYRL LEFLVALCVV AYGVSETIFG EWTVMGSMII FIHSYYNVWL
510 520 530 540 550
RAQLGWKSFL LRRDAVNKIK SLPIATKEQL EKHNDICAIC YQDMKSAVIT
560 570 580 590 600
PCSHFFHAGC LKKWLYVQET CPLCHCHLKN SSQLPGLGTE PVLQPHAGAE
610 620 630 640 650
QNVMFQEGTE PPGQEHTPGT RIQEGSRDNN EYIARRPDNQ EGAFDPKEYP
660
HSAKDEAHPV ESA
Length:663
Mass (Da):75,617
Last modified:July 10, 2007 - v2
Checksum:iEAE984696500ABD3
GO
Isoform 2 (identifier: Q96MT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMRNHRIASSLCGDQVFSKKKKKKKKNNM

Show »
Length:691
Mass (Da):78,905
Checksum:iB981A095846EB21D
GO
Isoform 3 (identifier: Q96MT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEVVFSKKKKKKKKNNM

Note: No experimental confirmation available.
Show »
Length:680
Mass (Da):77,635
Checksum:iC1F1EC3ECDDD18CC
GO
Isoform 4 (identifier: Q96MT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFSKKKKKKKKNNM

Note: No experimental confirmation available.
Show »
Length:677
Mass (Da):77,335
Checksum:i14F56CB45C03474E
GO
Isoform 5 (identifier: Q96MT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHRDRISPSNSPTWSLQVFSKKKKKKKKNNM

Note: No experimental confirmation available.
Show »
Length:693
Mass (Da):79,198
Checksum:iB31C1F06B683C778
GO

Sequence cautioni

The sequence AK308394 differs from that shown. Reason: Frameshift at position 189.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti9A → V in AAH42684 (PubMed:15489334).Curated1
Sequence conflicti383V → A in AAH42684 (PubMed:15489334).Curated1
Sequence conflicti501R → W in AK308394 (PubMed:14702039).Curated1
Sequence conflicti657A → V in AAH42684 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0375011M → MMRNHRIASSLCGDQVFSKK KKKKKKNNM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0436611M → MAEVVFSKKKKKKKKNNM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0436621M → MVFSKKKKKKKKNNM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0445391M → MHRDRISPSNSPTWSLQVFS KKKKKKKKNNM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056513 mRNA Translation: BAB71200.1
AK304228 mRNA Translation: BAH14139.1
AK304435 mRNA Translation: BAH14185.1
AK308394 mRNA No translation available.
AC134043 Genomic DNA No translation available.
BC042684 mRNA Translation: AAH42684.1
CCDSiCCDS4344.1 [Q96MT1-2]
CCDS56390.1 [Q96MT1-1]
CCDS56391.1 [Q96MT1-4]
CCDS56392.1 [Q96MT1-3]
CCDS56393.1 [Q96MT1-5]
RefSeqiNP_001186309.1, NM_001199380.1 [Q96MT1-5]
NP_001186310.1, NM_001199381.1 [Q96MT1-3]
NP_001186311.1, NM_001199382.1 [Q96MT1-4]
NP_001186312.1, NM_001199383.1 [Q96MT1-1]
NP_653327.1, NM_144726.2 [Q96MT1-2]
XP_016864627.1, XM_017009138.1 [Q96MT1-1]
UniGeneiHs.349306

Genome annotation databases

EnsembliENST00000274542; ENSP00000274542; ENSG00000145860 [Q96MT1-2]
ENST00000424310; ENSP00000409064; ENSG00000145860 [Q96MT1-1]
ENST00000518802; ENSP00000430955; ENSG00000145860 [Q96MT1-5]
ENST00000519865; ENSP00000430397; ENSG00000145860 [Q96MT1-1]
ENST00000520638; ENSP00000429071; ENSG00000145860 [Q96MT1-4]
ENST00000521606; ENSP00000430753; ENSG00000145860 [Q96MT1-3]
ENST00000611185; ENSP00000482720; ENSG00000145860 [Q96MT1-1]
GeneIDi153830
KEGGihsa:153830
UCSCiuc003lxo.2 human [Q96MT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRN145_HUMAN
AccessioniPrimary (citable) accession number: Q96MT1
Secondary accession number(s): B7Z903
, B7Z949, E7EVI7, Q8IVP7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: July 18, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health