Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (12 Aug 2020)
Sequence version 2 (11 Oct 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Heparan-sulfate 6-O-sulfotransferase 2

Gene

HS6ST2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei280SubstrateBy similarity1
Binding sitei285SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei290Proton acceptorBy similarity1
Binding sitei290SubstrateBy similarity1
Binding sitei325PAPSBy similarity1
Binding sitei333PAPSBy similarity1
Binding sitei337SubstrateBy similarity1
Binding sitei344SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q96MM7

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2022928, HS-GAG biosynthesis

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Heparan-sulfate 6-O-sulfotransferase 2Curated (EC:2.8.2.-1 Publication)
Short name:
HS6ST-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HS6ST2Imported
ORF Names:PSEC0092
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000171004.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19133, HS6ST2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
300545, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96MM7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 4CytoplasmicSequence analysis4
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei5 – 27Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini28 – 605LumenalSequence analysisAdd BLAST578

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Paganini-Miozzo syndrome (MRXSPM)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionAn X-linked, syndromic, neurodevelopmental disorder characterized by intellectual disability, global developmental delay, severe myopia, and mild facial dysmorphism.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_082055306G → R in MRXSPM; unknown pathological significance; reduced sulfotransferase activity; no effect on protein levels. 1 PublicationCorresponds to variant dbSNP:rs866919041EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
90161

MalaCards human disease database

More...
MalaCardsi
HS6ST2
MIMi301025, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000171004

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134950831

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96MM7, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HS6ST2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
77416506

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001908051 – 605Heparan-sulfate 6-O-sulfotransferase 2Add BLAST605

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi209N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi404N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi460N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi544N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi556N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi564N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi589N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi592N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96MM7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96MM7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96MM7

PeptideAtlas

More...
PeptideAtlasi
Q96MM7

PRoteomics IDEntifications database

More...
PRIDEi
Q96MM7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
19773
77375 [Q96MM7-1]
77376 [Q96MM7-2]
77377 [Q96MM7-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q96MM7, 8 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96MM7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96MM7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171004, Expressed in endothelial cell and 181 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96MM7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96MM7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000171004, Tissue enhanced (brain, kidney, ovary)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124671, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q96MM7, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000429473

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96MM7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96MM7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni233 – 241PAPS bindingBy similarity9
Regioni263 – 264Substrate bindingBy similarity2
Regioni457 – 459PAPS bindingBy similarity3
Regioni463 – 464PAPS bindingBy similarity2

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the sulfotransferase 6 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3955, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183071

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_027877_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96MM7

KEGG Orthology (KO)

More...
KOi
K08102

Identification of Orthologs from Complete Genome Data

More...
OMAi
CVPSRMD

Database of Orthologous Groups

More...
OrthoDBi
1167623at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96MM7

TreeFam database of animal gene trees

More...
TreeFami
TF312835

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR010635, Heparan_SO4-6-sulfoTrfase
IPR027417, P-loop_NTPase
IPR005331, Sulfotransferase

The PANTHER Classification System

More...
PANTHERi
PTHR12812, PTHR12812, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03567, Sulfotransfer_2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96MM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALPACAVRE FEPPRQPERG APVRTTCPRR HSRVEAELAA SRPGSVAASV
60 70 80 90 100
RAGPPRGVSH GFHTRPLLDK PRKASSSLAG AACAPLFALL SRGRRRRMHV
110 120 130 140 150
LRRRWDLGSL CRALLTRGLA ALGHSLKHVL GAIFSKIFGP MASVGNMDEK
160 170 180 190 200
SNKLLLALVM LFLFAVIVLQ YVCPGTECQL LRLQAFSSPV PDPYRSEDES
210 220 230 240 250
SARFVPRYNF TRGDLLRKVD FDIKGDDLIV FLHIQKTGGT TFGRHLVRNI
260 270 280 290 300
QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV
310 320 330 340 350
PSVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV
360 370 380 390 400
CDGRPPTSEE LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV
410 420 430 440 450
GCYNLSVMPE KQRNKVLLES AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM
460 470 480 490 500
NFISPFTQYN TTRASSVEIN EEIQKRIEGL NFLDMELYSY AKDLFLQRYQ
510 520 530 540 550
FMRQKEHQEA RRKRQEQRKF LKGRLLQTHF QSQGQGQSQN PNQNQSQNPN
560 570 580 590 600
PNANQNLTQN LMQNLTQSLS QKENRESPKQ NSGKEQNDNT SNGTNDYIGS

VEKWR
Length:605
Mass (Da):69,130
Last modified:October 11, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i10528AC424935B13
GO
Isoform 2 (identifier: Q96MM7-2) [UniParc]FASTAAdd to basket
Also known as: HS6ST-2S

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:459
Mass (Da):53,436
Checksum:i74B35C8D212BA566
GO
Isoform 3 (identifier: Q96MM7-3) [UniParc]FASTAAdd to basket
Also known as: HS6ST-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
     315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

Show »
Length:499
Mass (Da):57,697
Checksum:iFE81141A7FF0B9E7
GO
Isoform 4 (identifier: Q96MM7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

Show »
Length:645
Mass (Da):73,391
Checksum:iBC025604FDC3669E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2PQ14A0A1W2PQ14_HUMAN
Heparan-sulfate 6-O-sulfotransferas...
HS6ST2
277Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti192D → G in BAB71260 (PubMed:14702039).Curated1
Sequence conflicti299C → Y in AAH37325 (PubMed:15489334).Curated1
Sequence conflicti426K → R in BAC11597 (PubMed:16303743).Curated1
Sequence conflicti568S → N in BAB71260 (PubMed:14702039).Curated1
Sequence conflicti580Q → R in BAC11597 (PubMed:16303743).Curated1
Sequence conflicti585E → G in BAC11597 (PubMed:16303743).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061828127K → N. Corresponds to variant dbSNP:rs7053397Ensembl.1
Natural variantiVAR_082055306G → R in MRXSPM; unknown pathological significance; reduced sulfotransferase activity; no effect on protein levels. 1 PublicationCorresponds to variant dbSNP:rs866919041EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0158461 – 146Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST146
Alternative sequenceiVSP_015847315 – 316SR → SRWRIFQILDAASKDKRGSP NTNAGANSPSSTKTRNTSKS GK in isoform 3 and isoform 4. 2 Publications2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB067776 mRNA Translation: BAC07183.1
AB067777 mRNA Translation: BAC07184.1
AK027720 mRNA Translation: BAB55322.1
AK056706 mRNA Translation: BAB71260.1
Z81365, Z86064 Genomic DNA Translation: CAX30811.1
Z81365, Z86064 Genomic DNA Translation: CAX30812.1
AL022309 Genomic DNA No translation available.
AL022159 Genomic DNA No translation available.
Z82205 Genomic DNA No translation available.
Z86064, Z81365 Genomic DNA Translation: CAI42774.1
Z86064, Z81365 Genomic DNA Translation: CAI42775.1
BC037325 mRNA Translation: AAH37325.1
BC094718 mRNA Translation: AAH94718.1
BC110620 mRNA Translation: AAI10621.1
BC110621 mRNA Translation: AAI10622.1
AK075402 mRNA Translation: BAC11597.1
AL831923 mRNA Translation: CAD38583.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48169.1 [Q96MM7-1]
CCDS48170.1 [Q96MM7-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001070656.1, NM_001077188.1 [Q96MM7-4]
NP_671704.3, NM_147175.3 [Q96MM7-1]
XP_005262547.1, XM_005262490.3
XP_011529708.1, XM_011531406.1 [Q96MM7-3]
XP_016885433.1, XM_017029944.1
XP_016885434.1, XM_017029945.1 [Q96MM7-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370833; ENSP00000359870; ENSG00000171004 [Q96MM7-4]
ENST00000370836; ENSP00000359873; ENSG00000171004 [Q96MM7-1]
ENST00000406696; ENSP00000384013; ENSG00000171004 [Q96MM7-1]
ENST00000521489; ENSP00000429473; ENSG00000171004 [Q96MM7-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
90161

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:90161

UCSC genome browser

More...
UCSCi
uc011mvd.2, human [Q96MM7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067776 mRNA Translation: BAC07183.1
AB067777 mRNA Translation: BAC07184.1
AK027720 mRNA Translation: BAB55322.1
AK056706 mRNA Translation: BAB71260.1
Z81365, Z86064 Genomic DNA Translation: CAX30811.1
Z81365, Z86064 Genomic DNA Translation: CAX30812.1
AL022309 Genomic DNA No translation available.
AL022159 Genomic DNA No translation available.
Z82205 Genomic DNA No translation available.
Z86064, Z81365 Genomic DNA Translation: CAI42774.1
Z86064, Z81365 Genomic DNA Translation: CAI42775.1
BC037325 mRNA Translation: AAH37325.1
BC094718 mRNA Translation: AAH94718.1
BC110620 mRNA Translation: AAI10621.1
BC110621 mRNA Translation: AAI10622.1
AK075402 mRNA Translation: BAC11597.1
AL831923 mRNA Translation: CAD38583.1
CCDSiCCDS48169.1 [Q96MM7-1]
CCDS48170.1 [Q96MM7-4]
RefSeqiNP_001070656.1, NM_001077188.1 [Q96MM7-4]
NP_671704.3, NM_147175.3 [Q96MM7-1]
XP_005262547.1, XM_005262490.3
XP_011529708.1, XM_011531406.1 [Q96MM7-3]
XP_016885433.1, XM_017029944.1
XP_016885434.1, XM_017029945.1 [Q96MM7-3]

3D structure databases

SMRiQ96MM7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124671, 13 interactors
IntActiQ96MM7, 7 interactors
STRINGi9606.ENSP00000429473

PTM databases

GlyGeniQ96MM7, 8 sites
iPTMnetiQ96MM7
PhosphoSitePlusiQ96MM7

Polymorphism and mutation databases

BioMutaiHS6ST2
DMDMi77416506

Proteomic databases

jPOSTiQ96MM7
MassIVEiQ96MM7
MaxQBiQ96MM7
PeptideAtlasiQ96MM7
PRIDEiQ96MM7
ProteomicsDBi19773
77375 [Q96MM7-1]
77376 [Q96MM7-2]
77377 [Q96MM7-3]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
Q96MM7, 7 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30253, 77 antibodies

Genome annotation databases

EnsembliENST00000370833; ENSP00000359870; ENSG00000171004 [Q96MM7-4]
ENST00000370836; ENSP00000359873; ENSG00000171004 [Q96MM7-1]
ENST00000406696; ENSP00000384013; ENSG00000171004 [Q96MM7-1]
ENST00000521489; ENSP00000429473; ENSG00000171004 [Q96MM7-4]
GeneIDi90161
KEGGihsa:90161
UCSCiuc011mvd.2, human [Q96MM7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90161
DisGeNETi90161
EuPathDBiHostDB:ENSG00000171004.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HS6ST2
HGNCiHGNC:19133, HS6ST2
HPAiENSG00000171004, Tissue enhanced (brain, kidney, ovary)
MalaCardsiHS6ST2
MIMi300545, gene
301025, phenotype
neXtProtiNX_Q96MM7
OpenTargetsiENSG00000171004
PharmGKBiPA134950831

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3955, Eukaryota
GeneTreeiENSGT00950000183071
HOGENOMiCLU_027877_1_0_1
InParanoidiQ96MM7
KOiK08102
OMAiCVPSRMD
OrthoDBi1167623at2759
PhylomeDBiQ96MM7
TreeFamiTF312835

Enzyme and pathway databases

PathwayCommonsiQ96MM7
ReactomeiR-HSA-2022928, HS-GAG biosynthesis

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
90161, 5 hits in 492 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HS6ST2, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
90161
PharosiQ96MM7, Tbio

Protein Ontology

More...
PROi
PR:Q96MM7
RNActiQ96MM7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171004, Expressed in endothelial cell and 181 other tissues
ExpressionAtlasiQ96MM7, baseline and differential
GenevisibleiQ96MM7, HS

Family and domain databases

InterProiView protein in InterPro
IPR010635, Heparan_SO4-6-sulfoTrfase
IPR027417, P-loop_NTPase
IPR005331, Sulfotransferase
PANTHERiPTHR12812, PTHR12812, 1 hit
PfamiView protein in Pfam
PF03567, Sulfotransfer_2, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiH6ST2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96MM7
Secondary accession number(s): B9WRT4
, B9WRT5, E9PDY5, Q2TB13, Q4VC07, Q6PIC4, Q86SM9, Q8N3T4, Q8NBN4, Q96SJ4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: October 11, 2005
Last modified: August 12, 2020
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again