Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heparan-sulfate 6-O-sulfotransferase 2

Gene

HS6ST2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

Catalytic activityi

3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei280SubstrateBy similarity1
Binding sitei285SubstrateBy similarity1
Active sitei290Proton acceptorBy similarity1
Binding sitei290SubstrateBy similarity1
Binding sitei325PAPSBy similarity1
Binding sitei333PAPSBy similarity1
Binding sitei337SubstrateBy similarity1
Binding sitei344SubstrateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase

Enzyme and pathway databases

ReactomeiR-HSA-2022928 HS-GAG biosynthesis

Names & Taxonomyi

Protein namesi
Recommended name:
Heparan-sulfate 6-O-sulfotransferase 2 (EC:2.8.2.-)
Short name:
HS6ST-2
Gene namesi
Name:HS6ST2
ORF Names:PSEC0092
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000171004.17
HGNCiHGNC:19133 HS6ST2
MIMi300545 gene
neXtProtiNX_Q96MM7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 4CytoplasmicSequence analysis4
Transmembranei5 – 27Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini28 – 605LumenalSequence analysisAdd BLAST578

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi90161
OpenTargetsiENSG00000171004
PharmGKBiPA134950831

Polymorphism and mutation databases

BioMutaiHS6ST2
DMDMi77416506

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001908051 – 605Heparan-sulfate 6-O-sulfotransferase 2Add BLAST605

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi209N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi404N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi460N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi544N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi556N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi564N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi589N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi592N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ96MM7
PeptideAtlasiQ96MM7
PRIDEiQ96MM7
ProteomicsDBi77375
77376 [Q96MM7-2]
77377 [Q96MM7-3]

PTM databases

iPTMnetiQ96MM7
PhosphoSitePlusiQ96MM7

Expressioni

Gene expression databases

BgeeiENSG00000171004
CleanExiHS_HS6ST2
ExpressionAtlasiQ96MM7 baseline and differential
GenevisibleiQ96MM7 HS

Organism-specific databases

HPAiHPA034625
HPA034626

Interactioni

Protein-protein interaction databases

BioGridi124671, 10 interactors
IntActiQ96MM7, 5 interactors

Structurei

3D structure databases

ProteinModelPortaliQ96MM7
SMRiQ96MM7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni233 – 241PAPS bindingBy similarity9
Regioni263 – 264Substrate bindingBy similarity2
Regioni457 – 459PAPS bindingBy similarity3
Regioni463 – 464PAPS bindingBy similarity2

Sequence similaritiesi

Belongs to the sulfotransferase 6 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000013468
HOVERGENiHBG083012
InParanoidiQ96MM7
KOiK08102
OMAiNYYYITI
OrthoDBiEOG091G08UD
PhylomeDBiQ96MM7
TreeFamiTF312835

Family and domain databases

InterProiView protein in InterPro
IPR010635 Heparan_SO4-6-sulfoTrfase
IPR027417 P-loop_NTPase
IPR005331 Sulfotransferase
PANTHERiPTHR12812 PTHR12812, 1 hit
PfamiView protein in Pfam
PF03567 Sulfotransfer_2, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96MM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALPACAVRE FEPPRQPERG APVRTTCPRR HSRVEAELAA SRPGSVAASV
60 70 80 90 100
RAGPPRGVSH GFHTRPLLDK PRKASSSLAG AACAPLFALL SRGRRRRMHV
110 120 130 140 150
LRRRWDLGSL CRALLTRGLA ALGHSLKHVL GAIFSKIFGP MASVGNMDEK
160 170 180 190 200
SNKLLLALVM LFLFAVIVLQ YVCPGTECQL LRLQAFSSPV PDPYRSEDES
210 220 230 240 250
SARFVPRYNF TRGDLLRKVD FDIKGDDLIV FLHIQKTGGT TFGRHLVRNI
260 270 280 290 300
QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV
310 320 330 340 350
PSVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV
360 370 380 390 400
CDGRPPTSEE LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV
410 420 430 440 450
GCYNLSVMPE KQRNKVLLES AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM
460 470 480 490 500
NFISPFTQYN TTRASSVEIN EEIQKRIEGL NFLDMELYSY AKDLFLQRYQ
510 520 530 540 550
FMRQKEHQEA RRKRQEQRKF LKGRLLQTHF QSQGQGQSQN PNQNQSQNPN
560 570 580 590 600
PNANQNLTQN LMQNLTQSLS QKENRESPKQ NSGKEQNDNT SNGTNDYIGS

VEKWR
Length:605
Mass (Da):69,130
Last modified:October 11, 2005 - v2
Checksum:i10528AC424935B13
GO
Isoform 2 (identifier: Q96MM7-2) [UniParc]FASTAAdd to basket
Also known as: HS6ST-2S

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:459
Mass (Da):53,436
Checksum:i74B35C8D212BA566
GO
Isoform 3 (identifier: Q96MM7-3) [UniParc]FASTAAdd to basket
Also known as: HS6ST-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
     315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

Note: No experimental confirmation available.
Show »
Length:499
Mass (Da):57,697
Checksum:iFE81141A7FF0B9E7
GO
Isoform 4 (identifier: Q96MM7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

Note: Gene prediction based on EST data.
Show »
Length:645
Mass (Da):73,391
Checksum:iBC025604FDC3669E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti192D → G in BAB71260 (PubMed:14702039).Curated1
Sequence conflicti299C → Y in AAH37325 (PubMed:15489334).Curated1
Sequence conflicti426K → R in BAC11597 (PubMed:16303743).Curated1
Sequence conflicti568S → N in BAB71260 (PubMed:14702039).Curated1
Sequence conflicti580Q → R in BAC11597 (PubMed:16303743).Curated1
Sequence conflicti585E → G in BAC11597 (PubMed:16303743).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061828127K → N. Corresponds to variant dbSNP:rs7053397Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0158461 – 146Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST146
Alternative sequenceiVSP_015847315 – 316SR → SRWRIFQILDAASKDKRGSP NTNAGANSPSSTKTRNTSKS GK in isoform 3 and isoform 4. 2 Publications2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB067776 mRNA Translation: BAC07183.1
AB067777 mRNA Translation: BAC07184.1
AK027720 mRNA Translation: BAB55322.1
AK056706 mRNA Translation: BAB71260.1
Z81365, Z86064 Genomic DNA Translation: CAX30811.1
Z81365, Z86064 Genomic DNA Translation: CAX30812.1
AL022309 Genomic DNA No translation available.
AL022159 Genomic DNA No translation available.
Z82205 Genomic DNA No translation available.
Z86064, Z81365 Genomic DNA Translation: CAI42774.1
Z86064, Z81365 Genomic DNA Translation: CAI42775.1
BC037325 mRNA Translation: AAH37325.1
BC094718 mRNA Translation: AAH94718.1
BC110620 mRNA Translation: AAI10621.1
BC110621 mRNA Translation: AAI10622.1
AK075402 mRNA Translation: BAC11597.1
AL831923 mRNA Translation: CAD38583.1
CCDSiCCDS48169.1 [Q96MM7-1]
CCDS48170.1 [Q96MM7-4]
RefSeqiNP_001070656.1, NM_001077188.1 [Q96MM7-4]
NP_671704.3, NM_147175.3 [Q96MM7-1]
XP_005262547.1, XM_005262490.3 [Q96MM7-4]
XP_011529708.1, XM_011531406.1 [Q96MM7-3]
XP_016885433.1, XM_017029944.1 [Q96MM7-1]
XP_016885434.1, XM_017029945.1 [Q96MM7-3]
UniGeneiHs.385956

Genome annotation databases

EnsembliENST00000370833; ENSP00000359870; ENSG00000171004 [Q96MM7-4]
ENST00000370836; ENSP00000359873; ENSG00000171004 [Q96MM7-1]
ENST00000406696; ENSP00000384013; ENSG00000171004 [Q96MM7-1]
ENST00000521489; ENSP00000429473; ENSG00000171004 [Q96MM7-4]
GeneIDi90161
KEGGihsa:90161
UCSCiuc011mvd.2 human [Q96MM7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiH6ST2_HUMAN
AccessioniPrimary (citable) accession number: Q96MM7
Secondary accession number(s): B9WRT4
, B9WRT5, E9PDY5, Q2TB13, Q4VC07, Q6PIC4, Q86SM9, Q8N3T4, Q8NBN4, Q96SJ4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: October 11, 2005
Last modified: June 20, 2018
This is version 126 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health