Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1M

Gene

PPM1M

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+Curated, Mn2+Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi223ManganeseSequence analysis1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
LigandMagnesium, Manganese, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein phosphatase 1M (EC:3.1.3.16)
Alternative name(s):
Protein phosphatase 2C isoform eta
Short name:
PP2C-eta
Short name:
PP2CE
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PPM1M
Synonyms:PPM1E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000164088.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26506 PPM1M

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608979 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96MI6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000164088

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671151

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PPM1M

Domain mapping of disease mutations (DMDM)

More...
DMDMi
41688718

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000577561 – 270Protein phosphatase 1MAdd BLAST270

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96MI6

PeptideAtlas

More...
PeptideAtlasi
Q96MI6

PRoteomics IDEntifications database

More...
PRIDEi
Q96MI6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77361
77362 [Q96MI6-2]
77363 [Q96MI6-3]
77364 [Q96MI6-4]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q96MI6

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96MI6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96MI6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164088 Expressed in 159 organ(s), highest expression level in blood

CleanEx database of gene expression profiles

More...
CleanExi
HS_PPM1E
HS_PPM1M

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96MI6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96MI6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036905
HPA062291

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126308, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q96MI6, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000387046

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q96MI6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 270PPM-type phosphatasePROSITE-ProRule annotationAdd BLAST270

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PP2C family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1323 Eukaryota
ENOG410XP4B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161084

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000251606

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG105802

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96MI6

KEGG Orthology (KO)

More...
KOi
K17507

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96MI6

TreeFam database of animal gene trees

More...
TreeFami
TF314700

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00143 PP2Cc, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015655 PP2C
IPR036457 PPM-type_dom_sf
IPR001932 PPM-type_phosphatase_dom

The PANTHER Classification System

More...
PANTHERi
PTHR13832 PTHR13832, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00481 PP2C, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00332 PP2Cc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF81606 SSF81606, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51746 PPM_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1Curated (identifier: Q96MI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHLNGRCICP SDPQFVEEKG IRAEDLVIGA LESAFQECDE VIGRELEASG
60 70 80 90 100
QMGGCTALVA VSLQGKLYMA NAGDSRAILV RRDEIRPLSF EFTPETERQR
110 120 130 140 150
IQQLAFVYPE LLAGEFTRLE FPRRLKGDDL GQKVLFRDHH MSGWSYKRVE
160 170 180 190 200
KSDLKYPLIH GQGRQARLLG TLAVSRGLGD HQLRVLDTNI QLKPFLLSVP
210 220 230 240 250
QVTVLDVDQL ELQEDDVVVM ATDGLWDVLS NEQVAWLVRS FLPGNQEDPH
260 270
RYCSCWGPAW AWVGASSKPK
Note: No experimental confirmation available.Curated
Length:270
Mass (Da):30,375
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFCBE6EDF7C127144
GO
Isoform 2Curated (identifier: Q96MI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP
     124-270: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:123
Mass (Da):13,330
Checksum:i8821EC221BBEA624
GO
Isoform 3Curated (identifier: Q96MI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-129: Missing.
     130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated
Show »
Length:169
Mass (Da):18,837
Checksum:iFCBC85A80A95B7A8
GO
Isoform 4Curated (identifier: Q96MI6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated
Show »
Length:247
Mass (Da):27,923
Checksum:i4738FD6CBF4613BB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7XGB9B7XGB9_HUMAN
Protein phosphatase 1M
PPM1M ppm1m
459Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3K4H7C3K4_HUMAN
Protein phosphatase 1M
PPM1M
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3S3H7C3S3_HUMAN
Protein phosphatase 1M
PPM1M
257Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0506601 – 129Missing in isoform 3. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_0506591 – 51Missing in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_050663105 – 123AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_050664124 – 270Missing in isoform 2. 1 PublicationAdd BLAST147
Alternative sequenceiVSP_050661130 – 144LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_050662252 – 270YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4. 2 PublicationsAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK056894 mRNA Translation: BAB71302.1
AK096681 mRNA Translation: BAC04839.1
AK129647 mRNA Translation: BAC85206.1
BC009644 mRNA Translation: AAH09644.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46840.1 [Q96MI6-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001116342.1, NM_001122870.2 [Q96MI6-4]
NP_653242.3, NM_144641.3

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.373560
Hs.731914

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296487; ENSP00000296487; ENSG00000164088 [Q96MI6-1]
ENST00000409502; ENSP00000387046; ENSG00000164088 [Q96MI6-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
132160

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:132160

UCSC genome browser

More...
UCSCi
uc003ddf.4 human [Q96MI6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056894 mRNA Translation: BAB71302.1
AK096681 mRNA Translation: BAC04839.1
AK129647 mRNA Translation: BAC85206.1
BC009644 mRNA Translation: AAH09644.1
CCDSiCCDS46840.1 [Q96MI6-4]
RefSeqiNP_001116342.1, NM_001122870.2 [Q96MI6-4]
NP_653242.3, NM_144641.3
UniGeneiHs.373560
Hs.731914

3D structure databases

ProteinModelPortaliQ96MI6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126308, 7 interactors
IntActiQ96MI6, 4 interactors
STRINGi9606.ENSP00000387046

PTM databases

DEPODiQ96MI6
iPTMnetiQ96MI6
PhosphoSitePlusiQ96MI6

Polymorphism and mutation databases

BioMutaiPPM1M
DMDMi41688718

Proteomic databases

PaxDbiQ96MI6
PeptideAtlasiQ96MI6
PRIDEiQ96MI6
ProteomicsDBi77361
77362 [Q96MI6-2]
77363 [Q96MI6-3]
77364 [Q96MI6-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
132160
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296487; ENSP00000296487; ENSG00000164088 [Q96MI6-1]
ENST00000409502; ENSP00000387046; ENSG00000164088 [Q96MI6-4]
GeneIDi132160
KEGGihsa:132160
UCSCiuc003ddf.4 human [Q96MI6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
132160
EuPathDBiHostDB:ENSG00000164088.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PPM1M
HGNCiHGNC:26506 PPM1M
HPAiHPA036905
HPA062291
MIMi608979 gene
neXtProtiNX_Q96MI6
OpenTargetsiENSG00000164088
PharmGKBiPA142671151

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1323 Eukaryota
ENOG410XP4B LUCA
GeneTreeiENSGT00940000161084
HOGENOMiHOG000251606
HOVERGENiHBG105802
InParanoidiQ96MI6
KOiK17507
PhylomeDBiQ96MI6
TreeFamiTF314700

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PPM1M human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
132160

Protein Ontology

More...
PROi
PR:Q96MI6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000164088 Expressed in 159 organ(s), highest expression level in blood
CleanExiHS_PPM1E
HS_PPM1M
ExpressionAtlasiQ96MI6 baseline and differential
GenevisibleiQ96MI6 HS

Family and domain databases

CDDicd00143 PP2Cc, 1 hit
InterProiView protein in InterPro
IPR015655 PP2C
IPR036457 PPM-type_dom_sf
IPR001932 PPM-type_phosphatase_dom
PANTHERiPTHR13832 PTHR13832, 1 hit
PfamiView protein in Pfam
PF00481 PP2C, 2 hits
SMARTiView protein in SMART
SM00332 PP2Cc, 1 hit
SUPFAMiSSF81606 SSF81606, 1 hit
PROSITEiView protein in PROSITE
PS51746 PPM_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPPM1M_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96MI6
Secondary accession number(s): Q8N8J9, Q96DB8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: December 1, 2001
Last modified: December 5, 2018
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again