Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q96M27 (PRRC1_HUMAN)

Entry version 138 (07 Apr 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Protein PRRC1

Gene

PRRC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96M27

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein PRRC1
Alternative name(s):
Proline-rich and coiled-coil-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PRRC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28164, PRRC1

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96M27

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000164244.20

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		133619

Open Targets

More...OpenTargetsi		ENSG00000164244

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162400175

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96M27, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PRRC1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74732288

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003073381 – 445Protein PRRC1Add BLAST445

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei209PhosphoserineCombined sources1
Modified residuei408PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96M27

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96M27

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96M27

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96M27

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96M27

PeptideAtlas

More...PeptideAtlasi		Q96M27

PRoteomics IDEntifications database

More...PRIDEi		Q96M27

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		77284 [Q96M27-1]
77285 [Q96M27-2]
77286 [Q96M27-3]
77287 [Q96M27-4]
77288 [Q96M27-5]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q96M27, 3 sites, 1 O-linked glycan (3 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96M27

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q96M27

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96M27

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 4 is specifically expressed in liver. Ubiquitously expressed with higher expression in kidney, liver and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000164244, Expressed in tibia and 233 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96M27, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000164244, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		126367, 36 interactors

Protein interaction database and analysis system

More...IntActi		Q96M27, 15 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000421965

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96M27, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi11 – 129Pro-richAdd BLAST119

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PRRC1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QUZV, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000003837

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_041959_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96M27

Identification of Orthologs from Complete Genome Data

More...OMAi		KAIAGMY

Database of Orthologous Groups

More...OrthoDBi		930508at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96M27

TreeFam database of animal gene trees

More...TreeFami		TF343676

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.90.950.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029001, ITPase-like_fam
IPR026533, NTPase/PRRC1
IPR026534, PRRC1

The PANTHER Classification System

More...PANTHERi		PTHR23276, PTHR23276, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01931, NTPase_I-T, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF52972, SSF52972, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96M27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMEESGIETT PPGTPPPNPA GLAATAMSST PVPLAATSSF SSPNVSSMES 
        60         70         80         90        100
FPPLAYSTPQ PPLPPVRPSA PLPFVPPPAV PSVPPLVTSM PPPVSPSTAA 
       110        120        130        140        150
AFGNPPVSHF PPSTSAPNTL LPAPPSGPPI SGFSVGSTYD ITRGHAGRAP 
       160        170        180        190        200
QTPLMPSFSA PSGTGLLPTP ITQQASLTSL AQGTGTTSAI TFPEEQEDPR 
       210        220        230        240        250
ITRGQDEASA GGIWGFIKGV AGNPMVKSVL DKTKHSVESM ITTLDPGMAP 
       260        270        280        290        300
YIKSGGELDI VVTSNKEVKV AAVRDAFQEV FGLAVVVGEA GQSNIAPQPV 
       310        320        330        340        350
GYAAGLKGAQ ERIDSLRRTG VIHEKQTAVS VENFIAELLP DKWFDIGCLV 
       360        370        380        390        400
VEDPVHGIHL ETFTQATPVP LEFVQQAQSL TPQDYNLRWS GLLVTVGEVL 
       410        420        430        440 
EKSLLNVSRT DWHMAFTGMS RRQMIYSAAR AIAGMYKQRL PPRTV
Length:445
Mass (Da):46,701
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i68FFE2C1992A2361
GO
Isoform 2 (identifier: Q96M27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-445: AGMYKQRLPPRTV → ENPQRAVAVHGLVEARNFPAPGDLVSLLLGTV

Note: Non-canonical splice sites for exon 9 and exon 10.Curated
Show »
Length:464
Mass (Da):48,525
Checksum:i29D15F64361FA999
GO
Isoform 3 (identifier: Q96M27-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-445: GMYKQRLPPRTV → DDYFPRIPKEQWQSMAWLKLEIFLPLVTW

Show »
Length:462
Mass (Da):48,907
Checksum:i2C98812E953CCB20
GO
Isoform 4 (identifier: Q96M27-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-311: E → A
     312-445: Missing.

Show »
Length:311
Mass (Da):31,426
Checksum:i82B7869DA6AB0D28
GO
Isoform 5 (identifier: Q96M27-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     377-377: A → VGFLLCFFIMLQRNLHYCFQNKNLFGFFVRNMFLILFQSFFF
     378-445: Missing.

Show »
Length:418
Mass (Da):44,084
Checksum:i4845139EE2F0110D
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH17066 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC03467 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti70A → T in CAH10384 (PubMed:17974005).Curated1
Sequence conflicti338L → S in CAH10384 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028720311E → A in isoform 4. 1 Publication1
Alternative sequenceiVSP_028721312 – 445Missing in isoform 4. 1 PublicationAdd BLAST134
Alternative sequenceiVSP_028722377A → VGFLLCFFIMLQRNLHYCFQ NKNLFGFFVRNMFLILFQSF FF in isoform 5. 1 Publication1
Alternative sequenceiVSP_028723378 – 445Missing in isoform 5. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_028724433 – 445AGMYK…PPRTV → ENPQRAVAVHGLVEARNFPA PGDLVSLLLGTV in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_028725434 – 445GMYKQ…PPRTV → DDYFPRIPKEQWQSMAWLKL EIFLPLVTW in isoform 3. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ427339 mRNA Translation: CAD22113.1
AJ441110 mRNA Translation: CAD29585.2
AJ496322 mRNA Translation: CAD42881.1
AJ515158 mRNA Translation: CAD56470.1
AJ515428 mRNA Translation: CAD56438.1
AJ515429 mRNA Translation: CAD56439.1
AK090486 mRNA Translation: BAC03467.1 Frameshift.
AK057437 mRNA Translation: BAB71487.1
AL831963 mRNA Translation: CAD38605.1
AL832600 mRNA Translation: CAH10384.1 Different termination.
CH471062 Genomic DNA Translation: EAW62402.1
CH471062 Genomic DNA Translation: EAW62405.1
BC017066 mRNA Translation: AAH17066.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4143.1 [Q96M27-1]
CCDS68943.1 [Q96M27-3]

NCBI Reference Sequences

More...RefSeqi		NP_001273737.1, NM_001286808.1 [Q96M27-3]
NP_570721.1, NM_130809.4 [Q96M27-1]
XP_006714592.1, XM_006714529.3 [Q96M27-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000296666; ENSP00000296666; ENSG00000164244 [Q96M27-1]
ENST00000442138; ENSP00000392873; ENSG00000164244 [Q96M27-5]
ENST00000512635; ENSP00000421965; ENSG00000164244 [Q96M27-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		133619

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:133619

UCSC genome browser

More...UCSCi		uc003kuj.6, human [Q96M27-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ427339 mRNA Translation: CAD22113.1
AJ441110 mRNA Translation: CAD29585.2
AJ496322 mRNA Translation: CAD42881.1
AJ515158 mRNA Translation: CAD56470.1
AJ515428 mRNA Translation: CAD56438.1
AJ515429 mRNA Translation: CAD56439.1
AK090486 mRNA Translation: BAC03467.1 Frameshift.
AK057437 mRNA Translation: BAB71487.1
AL831963 mRNA Translation: CAD38605.1
AL832600 mRNA Translation: CAH10384.1 Different termination.
CH471062 Genomic DNA Translation: EAW62402.1
CH471062 Genomic DNA Translation: EAW62405.1
BC017066 mRNA Translation: AAH17066.1 Different initiation.
CCDSiCCDS4143.1 [Q96M27-1]
CCDS68943.1 [Q96M27-3]
RefSeqiNP_001273737.1, NM_001286808.1 [Q96M27-3]
NP_570721.1, NM_130809.4 [Q96M27-1]
XP_006714592.1, XM_006714529.3 [Q96M27-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi126367, 36 interactors
IntActiQ96M27, 15 interactors
STRINGi9606.ENSP00000421965

PTM databases

GlyGeniQ96M27, 3 sites, 1 O-linked glycan (3 sites)
iPTMnetiQ96M27
MetOSiteiQ96M27
PhosphoSitePlusiQ96M27

Genetic variation databases

BioMutaiPRRC1
DMDMi74732288

Proteomic databases

EPDiQ96M27
jPOSTiQ96M27
MassIVEiQ96M27
MaxQBiQ96M27
PaxDbiQ96M27
PeptideAtlasiQ96M27
PRIDEiQ96M27
ProteomicsDBi77284 [Q96M27-1]
77285 [Q96M27-2]
77286 [Q96M27-3]
77287 [Q96M27-4]
77288 [Q96M27-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		45054, 60 antibodies

The DNASU plasmid repository

More...DNASUi		133619

Genome annotation databases

EnsembliENST00000296666; ENSP00000296666; ENSG00000164244 [Q96M27-1]
ENST00000442138; ENSP00000392873; ENSG00000164244 [Q96M27-5]
ENST00000512635; ENSP00000421965; ENSG00000164244 [Q96M27-3]
GeneIDi133619
KEGGihsa:133619
UCSCiuc003kuj.6, human [Q96M27-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		133619
DisGeNETi133619

GeneCards: human genes, protein and diseases

More...GeneCardsi		PRRC1
HGNCiHGNC:28164, PRRC1
HPAiENSG00000164244, Low tissue specificity
neXtProtiNX_Q96M27
OpenTargetsiENSG00000164244
PharmGKBiPA162400175
VEuPathDBiHostDB:ENSG00000164244.20

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QUZV, Eukaryota
GeneTreeiENSGT00390000003837
HOGENOMiCLU_041959_0_0_1
InParanoidiQ96M27
OMAiKAIAGMY
OrthoDBi930508at2759
PhylomeDBiQ96M27
TreeFamiTF343676

Enzyme and pathway databases

PathwayCommonsiQ96M27

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		133619, 16 hits in 995 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PRRC1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		133619
PharosiQ96M27, Tdark

Protein Ontology

More...PROi		PR:Q96M27
RNActiQ96M27, protein

Gene expression databases

BgeeiENSG00000164244, Expressed in tibia and 233 other tissues
GenevisibleiQ96M27, HS

Family and domain databases

Gene3Di3.90.950.10, 1 hit
InterProiView protein in InterPro
IPR029001, ITPase-like_fam
IPR026533, NTPase/PRRC1
IPR026534, PRRC1
PANTHERiPTHR23276, PTHR23276, 1 hit
PfamiView protein in Pfam
PF01931, NTPase_I-T, 1 hit
SUPFAMiSSF52972, SSF52972, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRRC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96M27
Secondary accession number(s): Q69YM8
, Q7L2U7, Q86Y42, Q8IVJ4, Q8IVL4, Q8NEZ7, Q96AJ3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 1, 2001
Last modified: April 7, 2021
This is version 138 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again