Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96LC9 (BMF_HUMAN)

Entry version 133 (22 Apr 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Bcl-2-modifying factor

Gene

BMF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in apoptosis. Isoform 1 seems to be the main initiator.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-111453 BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-HSA-139910 Activation of BMF and translocation to mitochondria

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q96LC9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bcl-2-modifying factor
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BMF
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:24132 BMF

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		606266 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96LC9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		90427

Open Targets

More...OpenTargetsi		ENSG00000104081

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134893658

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96LC9 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BMF

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001431111 – 184Bcl-2-modifying factorAdd BLAST184

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96LC9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96LC9

PeptideAtlas

More...PeptideAtlasi		Q96LC9

PRoteomics IDEntifications database

More...PRIDEi		Q96LC9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		77201 [Q96LC9-1]
77202 [Q96LC9-2]
77203 [Q96LC9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96LC9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96LC9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000104081 Expressed in thyroid gland and 131 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96LC9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96LC9 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000104081 Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1 and BCL2L2/BCL-w.

Interacts with the myosin V actin motor complex through its binding to DLC2 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		124716, 17 interactors

Protein interaction database and analysis system

More...IntActi		Q96LC9, 20 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000346697

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96LC9 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96LC9

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni67 – 75Interaction with DLC2By similarity9

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi133 – 147BH3Add BLAST15

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IHFT Eukaryota
ENOG410YIXY LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000017896

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_090680_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96LC9

KEGG Orthology (KO)

More...KOi		K17460

Identification of Orthologs from Complete Genome Data

More...OMAi		NGMLPCG

Database of Orthologous Groups

More...OrthoDBi		1454053at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96LC9

TreeFam database of animal gene trees

More...TreeFami		TF336039

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR028192 BMF

The PANTHER Classification System

More...PANTHERi		PTHR32014 PTHR32014, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15185 BMF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96LC9-1) [UniParc]FASTAAdd to basket
Also known as: BMF-I

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPSQCVEEL EDDVFQPEDG EPVTQPGSLL SADLFAQSLL DCPLSRLQLF 
        60         70         80         90        100
PLTHCCGPGL RPTSQEDKAT QTLSPASPSQ GVMLPCGVTE EPQRLFYGNA 
       110        120        130        140        150
GYRLPLPASF PAVLPIGEQP PEGQWQHQAE VQIARKLQCI ADQFHRLHVQ 
       160        170        180 
QHQQNQNRVW WQILLFLHNL ALNGEENRNG AGPR
Length:184
Mass (Da):20,508
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i21479B25CC727853
GO
Isoform 2 (identifier: Q96LC9-2) [UniParc]FASTAAdd to basket
Also known as: BMF-II

The sequence of this isoform differs from the canonical sequence as follows:
     131-151: Missing.

Show »
Length:163
Mass (Da):17,994
Checksum:i842BA90CD323E4A3
GO
Isoform 3 (identifier: Q96LC9-3) [UniParc]FASTAAdd to basket
Also known as: BMF-III

The sequence of this isoform differs from the canonical sequence as follows:
     98-129: GNAGYRLPLPASFPAVLPIGEQPPEGQWQHQA → APAEPKSCVVADPPLPAQPCFEWRREQERGRP
     130-184: Missing.

Show »
Length:129
Mass (Da):14,150
Checksum:i4147FE8EB6E14B25
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YNT3H0YNT3_HUMAN
Bcl-2-modifying factor
BMF
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YK50H0YK50_HUMAN
Bcl-2-modifying factor
BMF
13Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH60783 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15762 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61R → Q in AAH69328 (PubMed:15489334).Curated1
Sequence conflicti80Q → P in AAH69505 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01229398 – 129GNAGY…WQHQA → APAEPKSCVVADPPLPAQPC FEWRREQERGRP in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_012294130 – 184Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_012292131 – 151Missing in isoform 2. 1 PublicationAdd BLAST21

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY029254 mRNA Translation: AAK38748.1
AY222040 mRNA Translation: AAP22965.1
AY222041 mRNA Translation: AAP22966.1
AK024472 mRNA Translation: BAB15762.1 Different initiation.
BC060783 mRNA Translation: AAH60783.1 Different initiation.
BC069328 mRNA Translation: AAH69328.1
BC069505 mRNA Translation: AAH69505.1
BC070043 mRNA Translation: AAH70043.2
BC104983 mRNA Translation: AAI04984.1
BC104985 mRNA Translation: AAI04986.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10052.1 [Q96LC9-1]
CCDS32196.1 [Q96LC9-3]
CCDS45223.1 [Q96LC9-2]

NCBI Reference Sequences

More...RefSeqi		NP_001003940.1, NM_001003940.1 [Q96LC9-1]
NP_001003942.1, NM_001003942.1 [Q96LC9-2]
NP_001003943.1, NM_001003943.2 [Q96LC9-3]
NP_277038.1, NM_033503.3 [Q96LC9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000354670; ENSP00000346697; ENSG00000104081 [Q96LC9-1]
ENST00000397573; ENSP00000380703; ENSG00000104081 [Q96LC9-1]
ENST00000431415; ENSP00000396511; ENSG00000104081 [Q96LC9-2]
ENST00000558774; ENSP00000453913; ENSG00000104081 [Q96LC9-3]
ENST00000559701; ENSP00000453919; ENSG00000104081 [Q96LC9-3]
ENST00000561282; ENSP00000453522; ENSG00000104081 [Q96LC9-1]
ENST00000561360; ENSP00000453892; ENSG00000104081 [Q96LC9-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		90427

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:90427

UCSC genome browser

More...UCSCi		uc001zkt.6 human [Q96LC9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029254 mRNA Translation: AAK38748.1
AY222040 mRNA Translation: AAP22965.1
AY222041 mRNA Translation: AAP22966.1
AK024472 mRNA Translation: BAB15762.1 Different initiation.
BC060783 mRNA Translation: AAH60783.1 Different initiation.
BC069328 mRNA Translation: AAH69328.1
BC069505 mRNA Translation: AAH69505.1
BC070043 mRNA Translation: AAH70043.2
BC104983 mRNA Translation: AAI04984.1
BC104985 mRNA Translation: AAI04986.1
CCDSiCCDS10052.1 [Q96LC9-1]
CCDS32196.1 [Q96LC9-3]
CCDS45223.1 [Q96LC9-2]
RefSeqiNP_001003940.1, NM_001003940.1 [Q96LC9-1]
NP_001003942.1, NM_001003942.1 [Q96LC9-2]
NP_001003943.1, NM_001003943.2 [Q96LC9-3]
NP_277038.1, NM_033503.3 [Q96LC9-1]

3D structure databases

SMRiQ96LC9
ModBaseiSearch...

Protein-protein interaction databases

BioGridi124716, 17 interactors
IntActiQ96LC9, 20 interactors
STRINGi9606.ENSP00000346697

PTM databases

iPTMnetiQ96LC9
PhosphoSitePlusiQ96LC9

Polymorphism and mutation databases

BioMutaiBMF

Proteomic databases

MassIVEiQ96LC9
PaxDbiQ96LC9
PeptideAtlasiQ96LC9
PRIDEiQ96LC9
ProteomicsDBi77201 [Q96LC9-1]
77202 [Q96LC9-2]
77203 [Q96LC9-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1506 443 antibodies

The DNASU plasmid repository

More...DNASUi		90427

Genome annotation databases

EnsembliENST00000354670; ENSP00000346697; ENSG00000104081 [Q96LC9-1]
ENST00000397573; ENSP00000380703; ENSG00000104081 [Q96LC9-1]
ENST00000431415; ENSP00000396511; ENSG00000104081 [Q96LC9-2]
ENST00000558774; ENSP00000453913; ENSG00000104081 [Q96LC9-3]
ENST00000559701; ENSP00000453919; ENSG00000104081 [Q96LC9-3]
ENST00000561282; ENSP00000453522; ENSG00000104081 [Q96LC9-1]
ENST00000561360; ENSP00000453892; ENSG00000104081 [Q96LC9-1]
GeneIDi90427
KEGGihsa:90427
UCSCiuc001zkt.6 human [Q96LC9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		90427
DisGeNETi90427

GeneCards: human genes, protein and diseases

More...GeneCardsi		BMF
HGNCiHGNC:24132 BMF
HPAiENSG00000104081 Tissue enhanced (lymphoid)
MIMi606266 gene
neXtProtiNX_Q96LC9
OpenTargetsiENSG00000104081
PharmGKBiPA134893658

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IHFT Eukaryota
ENOG410YIXY LUCA
GeneTreeiENSGT00390000017896
HOGENOMiCLU_090680_0_0_1
InParanoidiQ96LC9
KOiK17460
OMAiNGMLPCG
OrthoDBi1454053at2759
PhylomeDBiQ96LC9
TreeFamiTF336039

Enzyme and pathway databases

ReactomeiR-HSA-111453 BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-HSA-139910 Activation of BMF and translocation to mitochondria
SIGNORiQ96LC9

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		BMF_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		90427
PharosiQ96LC9 Tbio

Protein Ontology

More...PROi		PR:Q96LC9
RNActiQ96LC9 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000104081 Expressed in thyroid gland and 131 other tissues
ExpressionAtlasiQ96LC9 baseline and differential
GenevisibleiQ96LC9 HS

Family and domain databases

InterProiView protein in InterPro
IPR028192 BMF
PANTHERiPTHR32014 PTHR32014, 1 hit
PfamiView protein in Pfam
PF15185 BMF, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBMF_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96LC9
Secondary accession number(s): Q2M396
, Q6NT30, Q6NT56, Q6P9F6, Q7Z7D4, Q7Z7D5, Q9H7K7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: December 1, 2001
Last modified: April 22, 2020
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again