Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fc receptor-like protein 1

Gene

FCRL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May function as an activating coreceptor in B-cells. May function in B-cells activation and differentiation.1 Publication

GO - Molecular functioni

  • coreceptor activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionReceptor

Names & Taxonomyi

Protein namesi
Recommended name:
Fc receptor-like protein 1
Short name:
FcR-like protein 1
Short name:
FcRL1
Alternative name(s):
Fc receptor homolog 1
Short name:
FcRH1
IFGP family protein 1
Short name:
hIFGP1
Immune receptor translocation-associated protein 5
CD_antigen: CD307a
Gene namesi
Name:FCRL1
Synonyms:FCRH1, IFGP1, IRTA5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000163534.14
HGNCiHGNC:18509 FCRL1
MIMi606508 gene
neXtProtiNX_Q96LA6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini17 – 307ExtracellularSequence analysisAdd BLAST291
Transmembranei308 – 328HelicalSequence analysisAdd BLAST21
Topological domaini329 – 429CytoplasmicSequence analysisAdd BLAST101

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi115350
OpenTargetsiENSG00000163534
PharmGKBiPA142671766

Polymorphism and mutation databases

BioMutaiFCRL1
DMDMi74760931

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000033163817 – 429Fc receptor-like protein 1Add BLAST413

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi38 ↔ 86PROSITE-ProRule annotation
Disulfide bondi134 ↔ 183PROSITE-ProRule annotation
Disulfide bondi229 ↔ 276PROSITE-ProRule annotation
Glycosylationi293N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

Phosphorylated on tyrosines upon activation.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ96LA6
PeptideAtlasiQ96LA6
PRIDEiQ96LA6
ProteomicsDBi77177
77178 [Q96LA6-2]
77179 [Q96LA6-3]
77180 [Q96LA6-4]

PTM databases

iPTMnetiQ96LA6
PhosphoSitePlusiQ96LA6

Expressioni

Tissue specificityi

Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level).4 Publications

Inductioni

Down-regulated in activated B-cells.1 Publication

Gene expression databases

BgeeiENSG00000163534 Expressed in 85 organ(s), highest expression level in spleen
CleanExiHS_FCRL1
GenevisibleiQ96LA6 HS

Organism-specific databases

HPAiHPA013323

Interactioni

Protein-protein interaction databases

BioGridi125427, 1 interactor
STRINGi9606.ENSP00000357158

Structurei

3D structure databases

ProteinModelPortaliQ96LA6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 104Ig-like C2-type 1Add BLAST88
Domaini109 – 200Ig-like C2-type 2Add BLAST92
Domaini208 – 291Ig-like C2-type 3Add BLAST84

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi354 – 359ITIM motif 16
Motifi367 – 372ITIM motif 26
Motifi379 – 384ITIM motif 36
Motifi410 – 415ITIM motif 46
Motifi423 – 428ITIM motif 56

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J91H Eukaryota
ENOG411153C LUCA
GeneTreeiENSGT00760000119130
HOGENOMiHOG000036945
HOVERGENiHBG074073
InParanoidiQ96LA6
KOiK06727
OMAiITFFWYK
OrthoDBiEOG091G03OP
PhylomeDBiQ96LA6
TreeFamiTF351107

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF13895 Ig_2, 2 hits
SMARTiView protein in SMART
SM00409 IG, 3 hits
SM00408 IGc2, 3 hits
SUPFAMiSSF48726 SSF48726, 3 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 3 hits

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96LA6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLPRLLLLIC APLCEPAELF LIASPSHPTE GSPVTLTCKM PFLQSSDAQF
60 70 80 90 100
QFCFFRDTRA LGPGWSSSPK LQIAAMWKED TGSYWCEAQT MASKVLRSRR
110 120 130 140 150
SQINVHRVPV ADVSLETQPP GGQVMEGDRL VLICSVAMGT GDITFLWYKG
160 170 180 190 200
AVGLNLQSKT QRSLTAEYEI PSVRESDAEQ YYCVAENGYG PSPSGLVSIT
210 220 230 240 250
VRIPVSRPIL MLRAPRAQAA VEDVLELHCE ALRGSPPILY WFYHEDITLG
260 270 280 290 300
SRSAPSGGGA SFNLSLTEEH SGNYSCEANN GLGAQRSEAV TLNFTVPTGA
310 320 330 340 350
RSNHLTSGVI EGLLSTLGPA TVALLFCYGL KRKIGRRSAR DPLRSLPSPL
360 370 380 390 400
PQEFTYLNSP TPGQLQPIYE NVNVVSGDEV YSLAYYNQPE QESVAAETLG
410 420
THMEDKVSLD IYSRLRKANI TDVDYEDAM
Length:429
Mass (Da):46,936
Last modified:December 1, 2001 - v1
Checksum:iF6BB19942C9C7C06
GO
Isoform 2 (identifier: Q96LA6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     395-395: Missing.

Show »
Length:428
Mass (Da):46,865
Checksum:iF20BA3110BBC7828
GO
Isoform 3 (identifier: Q96LA6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-334: Missing.
     372-429: VNVVSGDEVY...ITDVDYEDAM → EPREQSVAVHGRQQHSSEQKAQKPWGHIWRTRFP

Show »
Length:366
Mass (Da):40,435
Checksum:i6F79D0F9EBDE2AE0
GO
Isoform 4 (identifier: Q96LA6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     203-238: IPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPI → SKFHYPSFSQPVTNWAPHFPGAHKVSLGHAEEVQWG
     239-429: Missing.

Note: No experimental confirmation available.
Show »
Length:199
Mass (Da):22,068
Checksum:iB64B24B45F3C19B2
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_042923124V → M. Corresponds to variant dbSNP:rs12078586Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0332901 – 39Missing in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_033291203 – 238IPVSR…GSPPI → SKFHYPSFSQPVTNWAPHFP GAHKVSLGHAEEVQWG in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033292239 – 429Missing in isoform 4. 1 PublicationAdd BLAST191
Alternative sequenceiVSP_033293296 – 334Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_033294372 – 429VNVVS…YEDAM → EPREQSVAVHGRQQHSSEQK AQKPWGHIWRTRFP in isoform 3. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_033295395Missing in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY043464 mRNA Translation: AAK91777.1
AF329488 mRNA Translation: AAL23898.1
EF064734 Genomic DNA Translation: ABK41917.1
AK096690 mRNA Translation: BAC04842.1
AK315748 mRNA Translation: BAG38102.1
AL833970 mRNA Translation: CAD38815.1
AL139409 Genomic DNA No translation available.
AL356276 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52861.1
CH471121 Genomic DNA Translation: EAW52862.1
BC033690 mRNA Translation: AAH33690.1
CCDSiCCDS1170.1 [Q96LA6-1]
CCDS53382.1 [Q96LA6-3]
CCDS53383.1 [Q96LA6-2]
RefSeqiNP_001152869.1, NM_001159397.1 [Q96LA6-3]
NP_001152870.1, NM_001159398.1 [Q96LA6-2]
NP_443170.1, NM_052938.4 [Q96LA6-1]
UniGeneiHs.656112

Genome annotation databases

EnsembliENST00000358292; ENSP00000351039; ENSG00000163534 [Q96LA6-3]
ENST00000368176; ENSP00000357158; ENSG00000163534 [Q96LA6-1]
ENST00000491942; ENSP00000418130; ENSG00000163534 [Q96LA6-2]
GeneIDi115350
KEGGihsa:115350
UCSCiuc001frg.4 human [Q96LA6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY043464 mRNA Translation: AAK91777.1
AF329488 mRNA Translation: AAL23898.1
EF064734 Genomic DNA Translation: ABK41917.1
AK096690 mRNA Translation: BAC04842.1
AK315748 mRNA Translation: BAG38102.1
AL833970 mRNA Translation: CAD38815.1
AL139409 Genomic DNA No translation available.
AL356276 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52861.1
CH471121 Genomic DNA Translation: EAW52862.1
BC033690 mRNA Translation: AAH33690.1
CCDSiCCDS1170.1 [Q96LA6-1]
CCDS53382.1 [Q96LA6-3]
CCDS53383.1 [Q96LA6-2]
RefSeqiNP_001152869.1, NM_001159397.1 [Q96LA6-3]
NP_001152870.1, NM_001159398.1 [Q96LA6-2]
NP_443170.1, NM_052938.4 [Q96LA6-1]
UniGeneiHs.656112

3D structure databases

ProteinModelPortaliQ96LA6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125427, 1 interactor
STRINGi9606.ENSP00000357158

PTM databases

iPTMnetiQ96LA6
PhosphoSitePlusiQ96LA6

Polymorphism and mutation databases

BioMutaiFCRL1
DMDMi74760931

Proteomic databases

PaxDbiQ96LA6
PeptideAtlasiQ96LA6
PRIDEiQ96LA6
ProteomicsDBi77177
77178 [Q96LA6-2]
77179 [Q96LA6-3]
77180 [Q96LA6-4]

Protocols and materials databases

DNASUi115350
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358292; ENSP00000351039; ENSG00000163534 [Q96LA6-3]
ENST00000368176; ENSP00000357158; ENSG00000163534 [Q96LA6-1]
ENST00000491942; ENSP00000418130; ENSG00000163534 [Q96LA6-2]
GeneIDi115350
KEGGihsa:115350
UCSCiuc001frg.4 human [Q96LA6-1]

Organism-specific databases

CTDi115350
DisGeNETi115350
EuPathDBiHostDB:ENSG00000163534.14
GeneCardsiFCRL1
HGNCiHGNC:18509 FCRL1
HPAiHPA013323
MIMi606508 gene
neXtProtiNX_Q96LA6
OpenTargetsiENSG00000163534
PharmGKBiPA142671766
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J91H Eukaryota
ENOG411153C LUCA
GeneTreeiENSGT00760000119130
HOGENOMiHOG000036945
HOVERGENiHBG074073
InParanoidiQ96LA6
KOiK06727
OMAiITFFWYK
OrthoDBiEOG091G03OP
PhylomeDBiQ96LA6
TreeFamiTF351107

Miscellaneous databases

ChiTaRSiFCRL1 human
GeneWikiiFCRL1
GenomeRNAii115350
PROiPR:Q96LA6
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163534 Expressed in 85 organ(s), highest expression level in spleen
CleanExiHS_FCRL1
GenevisibleiQ96LA6 HS

Family and domain databases

Gene3Di2.60.40.10, 3 hits
InterProiView protein in InterPro
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR003598 Ig_sub2
PfamiView protein in Pfam
PF13895 Ig_2, 2 hits
SMARTiView protein in SMART
SM00409 IG, 3 hits
SM00408 IGc2, 3 hits
SUPFAMiSSF48726 SSF48726, 3 hits
PROSITEiView protein in PROSITE
PS50835 IG_LIKE, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiFCRL1_HUMAN
AccessioniPrimary (citable) accession number: Q96LA6
Secondary accession number(s): B2RE05
, Q8N759, Q8NDI0, Q96PJ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 149 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again