Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ecto-ADP-ribosyltransferase 5

Gene

ART5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei99NADBy similarity1
Binding sitei160NADBy similarity1
Binding sitei180NADBy similarity1
Binding sitei214NADBy similarity1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei228By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • NAD(P)+-protein-arginine ADP-ribosyltransferase activity Source: UniProtKB-EC
  • NAD+ ADP-ribosyltransferase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase
LigandNAD, NADP

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ecto-ADP-ribosyltransferase 5 (EC:2.4.2.31)
Alternative name(s):
ADP-ribosyltransferase C2 and C3 toxin-like 5
Short name:
ARTC5
Mono(ADP-ribosyl)transferase 5
NAD(P)(+)--arginine ADP-ribosyltransferase 5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ART5
ORF Names:UNQ575/PRO1137
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000167311.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24049 ART5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610625 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96L15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000167311

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134887713

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ART5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296439487

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001933323 – 291Ecto-ADP-ribosyltransferase 5Add BLAST269

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi42 ↔ 258By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi101N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi196N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi250N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96L15

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96L15

PeptideAtlas

More...
PeptideAtlasi
Q96L15

PRoteomics IDEntifications database

More...
PRIDEi
Q96L15

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77139
77140 [Q96L15-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96L15

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96L15

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167311 Expressed in 82 organ(s), highest expression level in right testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_ART5

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96L15 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96L15 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA041637
HPA044099

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125545, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000352992

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q96L15

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96L15

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVE0 Eukaryota
ENOG4111WZG LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153465

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000273888

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG004464

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96L15

KEGG Orthology (KO)

More...
KOi
K19977

Identification of Orthologs from Complete Genome Data

More...
OMAi
LHFEPKR

Database of Orthologous Groups

More...
OrthoDBi
963174at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96L15

TreeFam database of animal gene trees

More...
TreeFami
TF335356

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000768 ART

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01129 ART, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00970 RIBTRNSFRASE

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01291 ART, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96L15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALAALMIAL GSLGLHTWQA QAVPILPLGL APDTFDDTYV GCAEEMEEKA
60 70 80 90 100
APLLKEEMAH HALLRESWEA AQETWEDKRR GLTLPPGFKA QNGIAIMVYT
110 120 130 140 150
NSSNTLYWEL NQAVRTGGGS RELYMRHFPF KALHFYLIRA LQLLRGSGGC
160 170 180 190 200
SRGPGEVVFR GVGSLRFEPK RLGDSVRLGQ FASSSLDKAV AHRFGNATLF
210 220 230 240 250
SLTTCFGAPI QAFSVFPKER EVLIPPHEVF LVTRFSQDGA QSLVTLWSYN
260 270 280 290
QTCSHFNCAY LGGEKRRGCV SAPGALGTGD LHMTKRHLQQ P
Length:291
Mass (Da):32,054
Last modified:May 18, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9783A0473FB4613E
GO
Isoform 2 (identifier: Q96L15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-262: Missing.
     275-291: ALGTGDLHMTKRHLQQP → VQLGSQSEGASSLPPWKTLLLAPGEFQLSGVGP

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):25,963
Checksum:iBA4A6D7AB29A73BD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C1W0H7C1W0_HUMAN
NAD(P)(+)--arginine ADP-ribosyltran...
ART5
264Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C3U2H7C3U2_HUMAN
NAD(P)(+)--arginine ADP-ribosyltran...
ART5
151Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti43A → V in AAH14577 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06314324P → PT4 PublicationsCorresponds to variant dbSNP:rs72515796Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_013145195 – 262Missing in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_013146275 – 291ALGTG…HLQQP → VQLGSQSEGASSLPPWKTLL LAPGEFQLSGVGP in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Y16835 mRNA Translation: CAC79987.1
AY358466 mRNA Translation: AAQ88831.1
AC060812 Genomic DNA No translation available.
CH471158 Genomic DNA Translation: EAX02556.1
BC014577 mRNA Translation: AAH14577.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73242.1 [Q96L15-2]
CCDS7743.1 [Q96L15-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001073004.1, NM_001079536.1 [Q96L15-1]
NP_001284597.1, NM_001297668.1 [Q96L15-2]
NP_443750.2, NM_053017.4 [Q96L15-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.125680

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000359918; ENSP00000352992; ENSG00000167311 [Q96L15-1]
ENST00000397067; ENSP00000380257; ENSG00000167311 [Q96L15-2]
ENST00000397068; ENSP00000380258; ENSG00000167311 [Q96L15-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
116969

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:116969

UCSC genome browser

More...
UCSCi
uc001lyb.2 human [Q96L15-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16835 mRNA Translation: CAC79987.1
AY358466 mRNA Translation: AAQ88831.1
AC060812 Genomic DNA No translation available.
CH471158 Genomic DNA Translation: EAX02556.1
BC014577 mRNA Translation: AAH14577.1
CCDSiCCDS73242.1 [Q96L15-2]
CCDS7743.1 [Q96L15-1]
RefSeqiNP_001073004.1, NM_001079536.1 [Q96L15-1]
NP_001284597.1, NM_001297668.1 [Q96L15-2]
NP_443750.2, NM_053017.4 [Q96L15-1]
UniGeneiHs.125680

3D structure databases

ProteinModelPortaliQ96L15
SMRiQ96L15
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125545, 5 interactors
STRINGi9606.ENSP00000352992

PTM databases

iPTMnetiQ96L15
PhosphoSitePlusiQ96L15

Polymorphism and mutation databases

BioMutaiART5
DMDMi296439487

Proteomic databases

EPDiQ96L15
PaxDbiQ96L15
PeptideAtlasiQ96L15
PRIDEiQ96L15
ProteomicsDBi77139
77140 [Q96L15-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
116969
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359918; ENSP00000352992; ENSG00000167311 [Q96L15-1]
ENST00000397067; ENSP00000380257; ENSG00000167311 [Q96L15-2]
ENST00000397068; ENSP00000380258; ENSG00000167311 [Q96L15-1]
GeneIDi116969
KEGGihsa:116969
UCSCiuc001lyb.2 human [Q96L15-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
116969
EuPathDBiHostDB:ENSG00000167311.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ART5

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0009376
HGNCiHGNC:24049 ART5
HPAiHPA041637
HPA044099
MIMi610625 gene
neXtProtiNX_Q96L15
OpenTargetsiENSG00000167311
PharmGKBiPA134887713

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVE0 Eukaryota
ENOG4111WZG LUCA
GeneTreeiENSGT00940000153465
HOGENOMiHOG000273888
HOVERGENiHBG004464
InParanoidiQ96L15
KOiK19977
OMAiLHFEPKR
OrthoDBi963174at2759
PhylomeDBiQ96L15
TreeFamiTF335356

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ART5 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
116969

Protein Ontology

More...
PROi
PR:Q96L15

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167311 Expressed in 82 organ(s), highest expression level in right testis
CleanExiHS_ART5
ExpressionAtlasiQ96L15 baseline and differential
GenevisibleiQ96L15 HS

Family and domain databases

InterProiView protein in InterPro
IPR000768 ART
PfamiView protein in Pfam
PF01129 ART, 1 hit
PRINTSiPR00970 RIBTRNSFRASE
PROSITEiView protein in PROSITE
PS01291 ART, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNAR5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96L15
Secondary accession number(s): C9IYG7, Q6UX84, Q86W02
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 13, 2002
Last sequence update: May 18, 2010
Last modified: January 16, 2019
This is version 137 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again