Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ecto-ADP-ribosyltransferase 5

Gene

ART5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

NAD+ + protein-L-arginine = nicotinamide + N(omega)-(ADP-D-ribosyl)-protein-L-arginine.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei99NADBy similarity1
Binding sitei160NADBy similarity1
Binding sitei180NADBy similarity1
Binding sitei214NADBy similarity1
Active sitei228By similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGlycosyltransferase, Transferase
LigandNAD, NADP

Names & Taxonomyi

Protein namesi
Recommended name:
Ecto-ADP-ribosyltransferase 5 (EC:2.4.2.31)
Alternative name(s):
ADP-ribosyltransferase C2 and C3 toxin-like 5
Short name:
ARTC5
Mono(ADP-ribosyl)transferase 5
NAD(P)(+)--arginine ADP-ribosyltransferase 5
Gene namesi
Name:ART5
ORF Names:UNQ575/PRO1137
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000167311.13
HGNCiHGNC:24049 ART5
MIMi610625 gene
neXtProtiNX_Q96L15

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000167311
PharmGKBiPA134887713

Polymorphism and mutation databases

BioMutaiART5
DMDMi296439487

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000001933323 – 291Ecto-ADP-ribosyltransferase 5Add BLAST269

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi42 ↔ 258By similarity
Glycosylationi101N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi196N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi250N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ96L15
PaxDbiQ96L15
PeptideAtlasiQ96L15
PRIDEiQ96L15
ProteomicsDBi77139
77140 [Q96L15-2]

PTM databases

iPTMnetiQ96L15
PhosphoSitePlusiQ96L15

Expressioni

Gene expression databases

BgeeiENSG00000167311
CleanExiHS_ART5
ExpressionAtlasiQ96L15 baseline and differential
GenevisibleiQ96L15 HS

Organism-specific databases

HPAiHPA041637
HPA044099

Interactioni

Protein-protein interaction databases

BioGridi125545, 5 interactors
STRINGi9606.ENSP00000352992

Structurei

3D structure databases

ProteinModelPortaliQ96L15
SMRiQ96L15
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IVE0 Eukaryota
ENOG4111WZG LUCA
GeneTreeiENSGT00530000062975
HOGENOMiHOG000273888
HOVERGENiHBG004464
InParanoidiQ96L15
KOiK19977
OMAiLHFEPKR
OrthoDBiEOG091G0BSN
PhylomeDBiQ96L15
TreeFamiTF335356

Family and domain databases

InterProiView protein in InterPro
IPR000768 ART
PfamiView protein in Pfam
PF01129 ART, 1 hit
PRINTSiPR00970 RIBTRNSFRASE
PROSITEiView protein in PROSITE
PS01291 ART, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96L15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALAALMIAL GSLGLHTWQA QAVPILPLGL APDTFDDTYV GCAEEMEEKA
60 70 80 90 100
APLLKEEMAH HALLRESWEA AQETWEDKRR GLTLPPGFKA QNGIAIMVYT
110 120 130 140 150
NSSNTLYWEL NQAVRTGGGS RELYMRHFPF KALHFYLIRA LQLLRGSGGC
160 170 180 190 200
SRGPGEVVFR GVGSLRFEPK RLGDSVRLGQ FASSSLDKAV AHRFGNATLF
210 220 230 240 250
SLTTCFGAPI QAFSVFPKER EVLIPPHEVF LVTRFSQDGA QSLVTLWSYN
260 270 280 290
QTCSHFNCAY LGGEKRRGCV SAPGALGTGD LHMTKRHLQQ P
Length:291
Mass (Da):32,054
Last modified:May 18, 2010 - v4
Checksum:i9783A0473FB4613E
GO
Isoform 2 (identifier: Q96L15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-262: Missing.
     275-291: ALGTGDLHMTKRHLQQP → VQLGSQSEGASSLPPWKTLLLAPGEFQLSGVGP

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):25,963
Checksum:iBA4A6D7AB29A73BD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti43A → V in AAH14577 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06314324P → PT4 PublicationsCorresponds to variant dbSNP:rs72515796Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_013145195 – 262Missing in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_013146275 – 291ALGTG…HLQQP → VQLGSQSEGASSLPPWKTLL LAPGEFQLSGVGP in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16835 mRNA Translation: CAC79987.1
AY358466 mRNA Translation: AAQ88831.1
AC060812 Genomic DNA No translation available.
CH471158 Genomic DNA Translation: EAX02556.1
BC014577 mRNA Translation: AAH14577.1
CCDSiCCDS73242.1 [Q96L15-2]
CCDS7743.1 [Q96L15-1]
RefSeqiNP_001073004.1, NM_001079536.1 [Q96L15-1]
NP_001284597.1, NM_001297668.1 [Q96L15-2]
NP_443750.2, NM_053017.4 [Q96L15-1]
UniGeneiHs.125680

Genome annotation databases

EnsembliENST00000359918; ENSP00000352992; ENSG00000167311 [Q96L15-1]
ENST00000397067; ENSP00000380257; ENSG00000167311 [Q96L15-2]
ENST00000397068; ENSP00000380258; ENSG00000167311 [Q96L15-1]
GeneIDi116969
KEGGihsa:116969
UCSCiuc001lyb.2 human [Q96L15-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiNAR5_HUMAN
AccessioniPrimary (citable) accession number: Q96L15
Secondary accession number(s): C9IYG7, Q6UX84, Q86W02
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 13, 2002
Last sequence update: May 18, 2010
Last modified: June 20, 2018
This is version 133 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health