Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (11 Dec 2019)
Sequence version 2 (10 Jun 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

WD repeat-containing protein 90

Gene

WDR90

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for efficient primary cilium formation.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • microtubule binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCilium biogenesis/degradation

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q96KV7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WD repeat-containing protein 90
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WDR90
Synonyms:C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, KIAA1924
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000161996.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26960 WDR90

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
618290 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96KV7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000161996

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145147652

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96KV7 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WDR90

Domain mapping of disease mutations (DMDM)

More...
DMDMi
190423649

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003414121 – 1748WD repeat-containing protein 90Add BLAST1748

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei241PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96KV7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96KV7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96KV7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96KV7

PeptideAtlas

More...
PeptideAtlasi
Q96KV7

PRoteomics IDEntifications database

More...
PRIDEi
Q96KV7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
77120 [Q96KV7-1]
77121 [Q96KV7-10]
77122 [Q96KV7-3]
77123 [Q96KV7-5]
77124 [Q96KV7-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96KV7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96KV7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000161996 Expressed in 166 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96KV7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96KV7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA049362
HPA061785

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q930623EBI-9478492,EBI-740322

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128250, 25 interactors

Protein interaction database and analysis system

More...
IntActi
Q96KV7, 23 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000293879

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96KV7 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96KV7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati407 – 450WD 1Add BLAST44
Repeati452 – 494WD 2Add BLAST43
Repeati501 – 541WD 3Add BLAST41
Repeati615 – 654WD 4Add BLAST40
Repeati656 – 695WD 5Add BLAST40
Repeati698 – 737WD 6Add BLAST40
Repeati740 – 779WD 7Add BLAST40
Repeati782 – 821WD 8Add BLAST40
Repeati882 – 922WD 9Add BLAST41
Repeati926 – 964WD 10Add BLAST39
Repeati969 – 1009WD 11Add BLAST41
Repeati1156 – 1201WD 12Add BLAST46
Repeati1204 – 1245WD 13Add BLAST42
Repeati1247 – 1286WD 14Add BLAST40
Repeati1298 – 1326WD 15Add BLAST29
Repeati1327 – 1376WD 16Add BLAST50
Repeati1433 – 1472WD 17Add BLAST40
Repeati1475 – 1520WD 18Add BLAST46
Repeati1523 – 1562WD 19Add BLAST40
Repeati1568 – 1614WD 20Add BLAST47
Repeati1715 – 1748WD 21Add BLAST34

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat WDR90/POC16 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0266 Eukaryota
KOG3213 Eukaryota
ENOG410XNWN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160173

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96KV7

Database of Orthologous Groups

More...
OrthoDBi
255317at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96KV7

TreeFam database of animal gene trees

More...
TreeFami
TF329419

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 7 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007714 CFA20_dom
IPR011047 Quinoprotein_ADH-like_supfam
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
IPR030466 WDR90

The PANTHER Classification System

More...
PANTHERi
PTHR13720:SF24 PTHR13720:SF24, 3 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05018 DUF667, 1 hit
PF00400 WD40, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 20 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 1 hit
SSF50998 SSF50998, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96KV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARAWQHPFL NVFRHFRVDE WKRSAKQGDV AVVTDKTLKG AVYRIRGSVS
60 70 80 90 100
AANYIQLPKS STQSLGLTGR YLYVLFRPLP SKHFVIHLDV SSKDNQVIRV
110 120 130 140 150
SFSNLFKEFK STATWLQFPL VLEARTPQRD LVGLAPSGAR WTCLQLDLQD
160 170 180 190 200
VLLVYLNRCY GHLKSIRLCA SLLVRNLYTS DLCFEPAISG AQWAKLPVTP
210 220 230 240 250
MPREMAFPVP KGESWHDRYI HVRFPSESLK VPSKPIEKSC SPPEAVLLGP
260 270 280 290 300
GPQPLPCPVA SSKPVRFSVS PVVQTPSPTA SGRAALAPRP FPEVSLSQER
310 320 330 340 350
SDASNADGPG FHSLEPWAQL EASDIHTAAA GTHVLTHESA EVPVARTGSC
360 370 380 390 400
EGFLPDPVLR LKGVIGFGGH GTRQALWTPD GAAVVYPCHA VIVVLLVDTG
410 420 430 440 450
EQRFFLGHTD KVSALALDGS SSLLASAQAR APSVMRLWDF QTGRCLCLFR
460 470 480 490 500
SPMHVVCSLS FSDSGALLCG VGKDHHGRTM VVAWGTGQVG LGGEVVVLAK
510 520 530 540 550
AHTDFDVQAF RVTFFDETRM ASCGQGSVRL WRLRGGVLRS CPVDLGEHHA
560 570 580 590 600
LQFTDLAFKQ ARDGCPEPSA AMLFVCSRSG HILEIDCQRM VVRHARRLLP
610 620 630 640 650
TRTPGGPHPQ KQTFSSGPGI AISSLSVSPA MCAVGSEDGF LRLWPLDFSS
660 670 680 690 700
VLLEAEHEGP VSSVCVSPDG LRVLSATSSG HLGFLDTLSR VYHMLARSHT
710 720 730 740 750
APVLALAMEQ RRGQLATVSQ DRTVRIWDLA TLQQLYDFTS SEDAPCAVTF
760 770 780 790 800
HPTRPTFFCG FSSGAVRSFS LEAAEVLVEH TCHRGAVTGL TATPDGRLLF
810 820 830 840 850
SSCSQGSLAQ YSCADPQWHV LRVAADMVCP DAPASPSALA VSRDGRLLAF
860 870 880 890 900
VGPSRCTVTV MGSASLDELL RVDIGTLDLA SSRLDSAMAV CFGPAALGHL
910 920 930 940 950
LVSTSSNRVV VLDAVSGRII RELPGVHPEP CPSLTLSEDA RFLLIAAGRT
960 970 980 990 1000
IKVWDYATQA SPGPQVYIGH SEPVQAVAFS PDQQQVLSAG DAVFLWDVLA
1010 1020 1030 1040 1050
PTESDQSFPG APPACKTGPG AGPLEDAASR ASELPRQQVP KPCQASPPRL
1060 1070 1080 1090 1100
GVCARPPEGG DGARDTRNSG APRTTYLASC KAFTPARVSC SPHSAKGTCP
1110 1120 1130 1140 1150
PPASGGWLRL KAVVGYSGNG RANMVWRPDT GFFAYTCGRL VVVEDLHSGA
1160 1170 1180 1190 1200
QQHWSGHSAE ISTLALSHSA QVLASASGRS STTAHCQIRV WDVSGGLCQH
1210 1220 1230 1240 1250
LIFPHSTTVL ALAFSPDDRL LVTLGDHDGR TLALWGTATY DLVSSTRLPE
1260 1270 1280 1290 1300
PVHGVAFNPW DAGELTCVGQ GTVTFWLLQQ RGADISLQVR REPVPEAVGA
1310 1320 1330 1340 1350
GELTSLCYGA PPLLYCGTSS GQVCVWDTRA GRCFLSWEAD DGGIGLLLFS
1360 1370 1380 1390 1400
GSRLVSGSST GRLRLWAVGA VSELRCKGSG ASSVFMEHEL VLDGAVVSAS
1410 1420 1430 1440 1450
FDDSVDMGVV GTTAGTLWFV SWAEGTSTRL ISGHRSKVNE VVFSPGESHC
1460 1470 1480 1490 1500
ATCSEDGSVR VWALASMELV IQFQVLNQSC LCLAWSPPCC GRPEQQRLAA
1510 1520 1530 1540 1550
GYGDGSLRIF SVSRTAMELK MHPHPVALTT VAFSTDGQTV LSGDKDGLVA
1560 1570 1580 1590 1600
VSHPCTGTTF RVLSDHQGAP ISTICVTCKE CEDLGVEGTD LWLAASGDQR
1610 1620 1630 1640 1650
VSVWASDWLR NHCELVDWLS FPMPATTETQ GHLPPSLAAF CPWDGALLMY
1660 1670 1680 1690 1700
VGPGVYKEVI IYNLCQKQVV EKIPLPFFAM SLSLSPGTHL LAVGFAECML
1710 1720 1730 1740
RLVDCAMGTA QDFAGHDNAV HLCRFTPSAR LLFTAARNEI LVWEVPGL
Length:1,748
Mass (Da):187,437
Last modified:June 10, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB9FC77D5F0FAAD9D
GO
Isoform 2 (identifier: Q96KV7-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1401: Missing.
     1402-1437: DDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSK → MLWFGQPGPGGWNRKCLRPFTLPRGQHPQPSYGFPQ
     1629-1672: TQGHLPPSLA...NLCQKQVVEK → VNHAPGTVGG...LPSALGMGRS
     1673-1748: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:271
Mass (Da):29,372
Checksum:i6680E355BF7B99A1
GO
Isoform 3 (identifier: Q96KV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-708: EHEGPVSSVC...HTAPVLALAM → GDAVGTLSQL...QVAYPEPWGG
     709-1748: Missing.

Show »
Length:708
Mass (Da):76,977
Checksum:iA171E6E92EDC81D7
GO
Isoform 4 (identifier: Q96KV7-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1401: Missing.
     1402-1437: DDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSK → MLWFGQPGPGGWNRKCLRPFTLPRGQHPQPSYGFPQ
     1580-1627: Missing.

Show »
Length:299
Mass (Da):32,434
Checksum:i48227B6EB6DAC52C
GO
Isoform 5 (identifier: Q96KV7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     280-280: A → AQ
     656-708: EHEGPVSSVC...HTAPVLALAM → GDAVGTLSQL...QVAYPEPWGG
     709-1748: Missing.

Show »
Length:709
Mass (Da):77,106
Checksum:iF65276B3F8EF49A6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VUX9F8VUX9_HUMAN
WD repeat-containing protein 90
WDR90
1,750Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI59H0YI59_HUMAN
WD repeat-containing protein 90
WDR90
475Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V201G3V201_HUMAN
HCG1985539, isoform CRA_e
WDR90 hCG_1985539
347Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHN4H0YHN4_HUMAN
WD repeat-containing protein 90
WDR90
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIW5H0YIW5_HUMAN
WD repeat-containing protein 90
WDR90
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHV6H0YHV6_HUMAN
WD repeat-containing protein 90
WDR90
115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI21186 differs from that shown. Reason: Frameshift.Curated
The sequence AAI21187 differs from that shown. Reason: Frameshift.Curated
The sequence AAK61239 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAB67817 differs from that shown. Intron retention.Curated
The sequence BAC03575 differs from that shown. Unlikely isoform. Aberrant splicing.Curated
The sequence BAC04205 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence BAC04225 differs from that shown. Probable cloning artifact.Curated
The sequence BAC04225 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAD18654 differs from that shown. Probable cloning artifact.Curated
The sequence EAW85775 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti899H → Q in BAD18654 (PubMed:14702039).Curated1
Sequence conflicti1085P → L in BAD18654 (PubMed:14702039).Curated1
Sequence conflicti1245S → P in BAC04225 (PubMed:14702039).Curated1
Sequence conflicti1302E → G in BAC04225 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_044060165S → T3 PublicationsCorresponds to variant dbSNP:rs13337278Ensembl.1
Natural variantiVAR_044061250P → L1 PublicationCorresponds to variant dbSNP:rs11642546Ensembl.1
Natural variantiVAR_044062537V → A1 PublicationCorresponds to variant dbSNP:rs3803697Ensembl.1
Natural variantiVAR_0440631001P → T1 PublicationCorresponds to variant dbSNP:rs4984906Ensembl.1
Natural variantiVAR_0440641492R → H. Corresponds to variant dbSNP:rs7190775Ensembl.1
Natural variantiVAR_0440651555C → R. Corresponds to variant dbSNP:rs11866949Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0342901 – 1401Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST1401
Alternative sequenceiVSP_034294280A → AQ in isoform 5. 1 Publication1
Alternative sequenceiVSP_034298656 – 708EHEGP…LALAM → GDAVGTLSQLPESLAWMLGR GRPSPRGSAVSRPGSWLHRV PRGQVAYPEPWGG in isoform 3 and isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_034300709 – 1748Missing in isoform 3 and isoform 5. 1 PublicationAdd BLAST1040
Alternative sequenceiVSP_0343031402 – 1437DDSVD…GHRSK → MLWFGQPGPGGWNRKCLRPF TLPRGQHPQPSYGFPQ in isoform 2 and isoform 4. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_0343061580 – 1627Missing in isoform 4. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_0410871629 – 1672TQGHL…QVVEK → VNHAPGTVGGAGTHPPHRSM LRLCRLRATWHPPSLPSALG MGRS in isoform 2. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_0410881673 – 1748Missing in isoform 2. 1 PublicationAdd BLAST76

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK091062 mRNA Translation: BAC03575.1 Sequence problems.
AK093609 mRNA Translation: BAC04205.1 Sequence problems.
AK093802 mRNA Translation: BAC04225.1 Sequence problems.
AK131510 mRNA Translation: BAD18654.1 Sequence problems.
AE006464 Genomic DNA Translation: AAK61239.1 Sequence problems.
AL022341 Genomic DNA No translation available.
Z92544 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85775.1 Sequence problems.
BC065836 mRNA Translation: AAH65836.1
BC121185 mRNA Translation: AAI21186.1 Frameshift.
BC121186 mRNA Translation: AAI21187.1 Frameshift.
AB067511 mRNA Translation: BAB67817.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42092.1 [Q96KV7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_660337.3, NM_145294.4 [Q96KV7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000293879; ENSP00000293879; ENSG00000161996 [Q96KV7-1]
ENST00000315764; ENSP00000322808; ENSG00000161996 [Q96KV7-7]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
197335

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:197335

UCSC genome browser

More...
UCSCi
uc002cii.2 human [Q96KV7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091062 mRNA Translation: BAC03575.1 Sequence problems.
AK093609 mRNA Translation: BAC04205.1 Sequence problems.
AK093802 mRNA Translation: BAC04225.1 Sequence problems.
AK131510 mRNA Translation: BAD18654.1 Sequence problems.
AE006464 Genomic DNA Translation: AAK61239.1 Sequence problems.
AL022341 Genomic DNA No translation available.
Z92544 Genomic DNA No translation available.
CH471112 Genomic DNA Translation: EAW85775.1 Sequence problems.
BC065836 mRNA Translation: AAH65836.1
BC121185 mRNA Translation: AAI21186.1 Frameshift.
BC121186 mRNA Translation: AAI21187.1 Frameshift.
AB067511 mRNA Translation: BAB67817.1 Sequence problems.
CCDSiCCDS42092.1 [Q96KV7-1]
RefSeqiNP_660337.3, NM_145294.4 [Q96KV7-1]

3D structure databases

SMRiQ96KV7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi128250, 25 interactors
IntActiQ96KV7, 23 interactors
STRINGi9606.ENSP00000293879

PTM databases

iPTMnetiQ96KV7
PhosphoSitePlusiQ96KV7

Polymorphism and mutation databases

BioMutaiWDR90
DMDMi190423649

Proteomic databases

jPOSTiQ96KV7
MassIVEiQ96KV7
MaxQBiQ96KV7
PaxDbiQ96KV7
PeptideAtlasiQ96KV7
PRIDEiQ96KV7
ProteomicsDBi77120 [Q96KV7-1]
77121 [Q96KV7-10]
77122 [Q96KV7-3]
77123 [Q96KV7-5]
77124 [Q96KV7-7]

Genome annotation databases

EnsembliENST00000293879; ENSP00000293879; ENSG00000161996 [Q96KV7-1]
ENST00000315764; ENSP00000322808; ENSG00000161996 [Q96KV7-7]
GeneIDi197335
KEGGihsa:197335
UCSCiuc002cii.2 human [Q96KV7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
197335
EuPathDBiHostDB:ENSG00000161996.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
WDR90
HGNCiHGNC:26960 WDR90
HPAiHPA049362
HPA061785
MIMi618290 gene
neXtProtiNX_Q96KV7
OpenTargetsiENSG00000161996
PharmGKBiPA145147652

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0266 Eukaryota
KOG3213 Eukaryota
ENOG410XNWN LUCA
GeneTreeiENSGT00940000160173
InParanoidiQ96KV7
OrthoDBi255317at2759
PhylomeDBiQ96KV7
TreeFamiTF329419

Enzyme and pathway databases

SignaLinkiQ96KV7

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
WDR90 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
197335
PharosiQ96KV7 Tdark

Protein Ontology

More...
PROi
PR:Q96KV7
RNActiQ96KV7 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000161996 Expressed in 166 organ(s), highest expression level in right testis
ExpressionAtlasiQ96KV7 baseline and differential
GenevisibleiQ96KV7 HS

Family and domain databases

Gene3Di2.130.10.10, 7 hits
InterProiView protein in InterPro
IPR007714 CFA20_dom
IPR011047 Quinoprotein_ADH-like_supfam
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
IPR030466 WDR90
PANTHERiPTHR13720:SF24 PTHR13720:SF24, 3 hits
PfamiView protein in Pfam
PF05018 DUF667, 1 hit
PF00400 WD40, 2 hits
SMARTiView protein in SMART
SM00320 WD40, 20 hits
SUPFAMiSSF50978 SSF50978, 1 hit
SSF50998 SSF50998, 2 hits
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWDR90_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96KV7
Secondary accession number(s): Q0VA87
, Q0VA88, Q6P048, Q6ZMS1, Q6ZTH1, Q8N202, Q8N221, Q8NBB8, Q96PW4, Q96S18
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: December 11, 2019
This is version 149 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again