Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (08 May 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Leishmanolysin-like peptidase

Gene

LMLN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Metalloprotease.By similarity

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi272Zinc; catalyticPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei273PROSITE-ProRule annotation1
Metal bindingi276Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi378Zinc; catalyticPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • metalloendopeptidase activity Source: InterPro
  • peptidase activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processCell cycle, Cell division, Mitosis
LigandMetal-binding, Zinc

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M08.003

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leishmanolysin-like peptidaseCurated (EC:3.4.24.-By similarity)
Alternative name(s):
Invadolysin1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMLN
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:15991 LMLN

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609380 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96KR4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Lipid droplet

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
89782

Open Targets

More...
OpenTargetsi
ENSG00000185621

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30402

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LMLN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296434578

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003030761 – 655Leishmanolysin-like peptidaseAdd BLAST655

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96KR4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96KR4

PeptideAtlas

More...
PeptideAtlasi
Q96KR4

PRoteomics IDEntifications database

More...
PRIDEi
Q96KR4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77106
77107 [Q96KR4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96KR4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96KR4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in all cell lines analyzed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185621 Expressed in 187 organ(s), highest expression level in prostate gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96KR4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96KR4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA016481
HPA028844

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124601, 11 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000410926

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M8 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008796

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007103

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96KR4

KEGG Orthology (KO)

More...
KOi
K13539

Identification of Orthologs from Complete Genome Data

More...
OMAi
GWLHKGA

Database of Orthologous Groups

More...
OrthoDBi
1310134at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96KR4

TreeFam database of animal gene trees

More...
TreeFami
TF315265

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001577 Peptidase_M8

The PANTHER Classification System

More...
PANTHERi
PTHR10942 PTHR10942, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01457 Peptidase_M8, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96KR4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVTTLGPKMA AEWGGGVGYS GSGPGRSRWR WSGSVWVRSV LLLLGGLRAS
60 70 80 90 100
ATSTPVSLGS SPPCRHHVPS DTEVINKVHL KANHVVKRDV DEHLRIKTVY
110 120 130 140 150
DKSVEELLPE KKNLVKNKLF PQAISYLEKT FQVRRPAGTI LLSRQCATNQ
160 170 180 190 200
YLRKENDPHR YCTGECAAHT KCGPVIVPEE HLQQCRVYRG GKWPHGAVGV
210 220 230 240 250
PDQEGISDAD FVLYVGALAT ERCSHENIIS YAAYCQQEAN MDRPIAGYAN
260 270 280 290 300
LCPNMISTQP QEFVGMLSTV KHEVIHALGF SAGLFAFYHD KDGNPLTSRF
310 320 330 340 350
ADGLPPFNYS LGLYQWSDKV VRKVERLWDV RDNKIVRHTV YLLVTPRVVE
360 370 380 390 400
EARKHFDCPV LEGMELENQG GVGTELNHWE KRLLENEAMT GSHTQNRVLS
410 420 430 440 450
RITLALMEDT GRQMLSPYCD TLRSNPLQLT CRQDQRAVAV CNLQKFPKPL
460 470 480 490 500
PQEYQYFDEL SGIPAEDLPY YGGSVEIADY CPFSQEFSWH LSGEYQRSSD
510 520 530 540 550
CRILENQPEI FKNYGAEKYG PHSVCLIQKS AFVMEKCERK LSYPDWGSGC
560 570 580 590 600
YQVSCSPQGL KVWVQDTSYL CSRAGQVLPV SIQMNGWIHD GNLLCPSCWD
610 620 630 640 650
FCELCPPETD PPATNLTRAL PLDLCSCSSS LVVTLWLLLG NLFPLLAGFL

LCIWH
Length:655
Mass (Da):73,568
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD6A767CE3FA7A915
GO
Isoform 2 (identifier: Q96KR4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MVTTLGPKMA...CRHHVPSDTE → MGRRSGLLGLRPGPEPVALER
     411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

Show »
Length:640
Mass (Da):72,780
Checksum:i272AB99BBE391B42
GO
Isoform 3 (identifier: Q96KR4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

Show »
Length:692
Mass (Da):78,111
Checksum:i3000E53236452C1D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WCE5F8WCE5_HUMAN
Leishmanolysin-like peptidase
LMLN
603Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JF40C9JF40_HUMAN
Leishmanolysin-like peptidase
LMLN
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti539R → K in CAP49203 (PubMed:19706689).Curated1
Sequence conflicti539R → K in CAP49204 (PubMed:19706689).Curated1
Sequence conflicti539R → K in CAC42882 (Ref. 2) Curated1
Sequence conflicti539R → K in CAC42883 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_060158106E → D. Corresponds to variant dbSNP:rs7373165Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0280021 – 73MVTTL…PSDTE → MGRRSGLLGLRPGPEPVALE R in isoform 2. 2 PublicationsAdd BLAST73
Alternative sequenceiVSP_028003411G → GWYKANYSMAEKLDWGRGMG CDFVRKSCKFWIDQQRQK in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AM920777 mRNA Translation: CAP49203.1
AM920778 mRNA Translation: CAP49204.1
AJ312398 mRNA Translation: CAC42882.1
AJ312399 mRNA Translation: CAC42883.1
AC135893 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3332.1 [Q96KR4-1]
CCDS46988.1 [Q96KR4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001129521.2, NM_001136049.2 [Q96KR4-3]
NP_149018.2, NM_033029.3 [Q96KR4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000330198; ENSP00000328829; ENSG00000185621 [Q96KR4-1]
ENST00000420910; ENSP00000410926; ENSG00000185621 [Q96KR4-3]
ENST00000482695; ENSP00000418324; ENSG00000185621 [Q96KR4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
89782

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:89782

UCSC genome browser

More...
UCSCi
uc003fyt.4 human [Q96KR4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM920777 mRNA Translation: CAP49203.1
AM920778 mRNA Translation: CAP49204.1
AJ312398 mRNA Translation: CAC42882.1
AJ312399 mRNA Translation: CAC42883.1
AC135893 Genomic DNA No translation available.
CCDSiCCDS3332.1 [Q96KR4-1]
CCDS46988.1 [Q96KR4-3]
RefSeqiNP_001129521.2, NM_001136049.2 [Q96KR4-3]
NP_149018.2, NM_033029.3 [Q96KR4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi124601, 11 interactors
STRINGi9606.ENSP00000410926

Protein family/group databases

MEROPSiM08.003

PTM databases

iPTMnetiQ96KR4
PhosphoSitePlusiQ96KR4

Polymorphism and mutation databases

BioMutaiLMLN
DMDMi296434578

Proteomic databases

EPDiQ96KR4
jPOSTiQ96KR4
PeptideAtlasiQ96KR4
PRIDEiQ96KR4
ProteomicsDBi77106
77107 [Q96KR4-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
89782
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000330198; ENSP00000328829; ENSG00000185621 [Q96KR4-1]
ENST00000420910; ENSP00000410926; ENSG00000185621 [Q96KR4-3]
ENST00000482695; ENSP00000418324; ENSG00000185621 [Q96KR4-2]
GeneIDi89782
KEGGihsa:89782
UCSCiuc003fyt.4 human [Q96KR4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
89782
DisGeNETi89782

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LMLN
HGNCiHGNC:15991 LMLN
HPAiHPA016481
HPA028844
MIMi609380 gene
neXtProtiNX_Q96KR4
OpenTargetsiENSG00000185621
PharmGKBiPA30402

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000008796
HOGENOMiHOG000007103
InParanoidiQ96KR4
KOiK13539
OMAiGWLHKGA
OrthoDBi1310134at2759
PhylomeDBiQ96KR4
TreeFamiTF315265

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
89782

Protein Ontology

More...
PROi
PR:Q96KR4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185621 Expressed in 187 organ(s), highest expression level in prostate gland
ExpressionAtlasiQ96KR4 baseline and differential
GenevisibleiQ96KR4 HS

Family and domain databases

InterProiView protein in InterPro
IPR001577 Peptidase_M8
PANTHERiPTHR10942 PTHR10942, 1 hit
PfamiView protein in Pfam
PF01457 Peptidase_M8, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLMLN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96KR4
Secondary accession number(s): B3LDG9
, B3LDH0, C9J796, F8WB28, Q96KR5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: May 18, 2010
Last modified: May 8, 2019
This is version 128 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again