Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leishmanolysin-like peptidase

Gene

LMLN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Metalloprotease.By similarity

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi272Zinc; catalyticPROSITE-ProRule annotation1
Active sitei273PROSITE-ProRule annotation1
Metal bindingi276Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi378Zinc; catalyticPROSITE-ProRule annotation1

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • metalloendopeptidase activity Source: InterPro
  • peptidase activity Source: GO_Central

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processCell cycle, Cell division, Mitosis
LigandMetal-binding, Zinc

Protein family/group databases

MEROPSiM08.003

Names & Taxonomyi

Protein namesi
Recommended name:
Leishmanolysin-like peptidaseCurated (EC:3.4.24.-By similarity)
Alternative name(s):
Invadolysin1 Publication
Gene namesi
Name:LMLN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000185621.11
HGNCiHGNC:15991 LMLN
MIMi609380 gene
neXtProtiNX_Q96KR4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Lipid droplet

Pathology & Biotechi

Organism-specific databases

DisGeNETi89782
OpenTargetsiENSG00000185621
PharmGKBiPA30402

Polymorphism and mutation databases

BioMutaiLMLN
DMDMi296434578

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003030761 – 655Leishmanolysin-like peptidaseAdd BLAST655

Proteomic databases

EPDiQ96KR4
PeptideAtlasiQ96KR4
PRIDEiQ96KR4
ProteomicsDBi77106
77107 [Q96KR4-2]

PTM databases

iPTMnetiQ96KR4
PhosphoSitePlusiQ96KR4

Expressioni

Tissue specificityi

Expressed in all cell lines analyzed.1 Publication

Gene expression databases

BgeeiENSG00000185621 Expressed in 187 organ(s), highest expression level in prostate gland
CleanExiHS_LMLN
ExpressionAtlasiQ96KR4 baseline and differential
GenevisibleiQ96KR4 HS

Organism-specific databases

HPAiHPA016481
HPA028844

Interactioni

Protein-protein interaction databases

BioGridi124601, 11 interactors

Structurei

3D structure databases

ProteinModelPortaliQ96KR4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M8 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000008796
HOGENOMiHOG000007103
HOVERGENiHBG087499
InParanoidiQ96KR4
KOiK13539
OMAiGWLHKGA
OrthoDBiEOG091G03XZ
PhylomeDBiQ96KR4
TreeFamiTF315265

Family and domain databases

InterProiView protein in InterPro
IPR001577 Peptidase_M8
PANTHERiPTHR10942 PTHR10942, 2 hits
PfamiView protein in Pfam
PF01457 Peptidase_M8, 3 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96KR4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVTTLGPKMA AEWGGGVGYS GSGPGRSRWR WSGSVWVRSV LLLLGGLRAS
60 70 80 90 100
ATSTPVSLGS SPPCRHHVPS DTEVINKVHL KANHVVKRDV DEHLRIKTVY
110 120 130 140 150
DKSVEELLPE KKNLVKNKLF PQAISYLEKT FQVRRPAGTI LLSRQCATNQ
160 170 180 190 200
YLRKENDPHR YCTGECAAHT KCGPVIVPEE HLQQCRVYRG GKWPHGAVGV
210 220 230 240 250
PDQEGISDAD FVLYVGALAT ERCSHENIIS YAAYCQQEAN MDRPIAGYAN
260 270 280 290 300
LCPNMISTQP QEFVGMLSTV KHEVIHALGF SAGLFAFYHD KDGNPLTSRF
310 320 330 340 350
ADGLPPFNYS LGLYQWSDKV VRKVERLWDV RDNKIVRHTV YLLVTPRVVE
360 370 380 390 400
EARKHFDCPV LEGMELENQG GVGTELNHWE KRLLENEAMT GSHTQNRVLS
410 420 430 440 450
RITLALMEDT GRQMLSPYCD TLRSNPLQLT CRQDQRAVAV CNLQKFPKPL
460 470 480 490 500
PQEYQYFDEL SGIPAEDLPY YGGSVEIADY CPFSQEFSWH LSGEYQRSSD
510 520 530 540 550
CRILENQPEI FKNYGAEKYG PHSVCLIQKS AFVMEKCERK LSYPDWGSGC
560 570 580 590 600
YQVSCSPQGL KVWVQDTSYL CSRAGQVLPV SIQMNGWIHD GNLLCPSCWD
610 620 630 640 650
FCELCPPETD PPATNLTRAL PLDLCSCSSS LVVTLWLLLG NLFPLLAGFL

LCIWH
Length:655
Mass (Da):73,568
Last modified:May 18, 2010 - v2
Checksum:iD6A767CE3FA7A915
GO
Isoform 2 (identifier: Q96KR4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MVTTLGPKMA...CRHHVPSDTE → MGRRSGLLGLRPGPEPVALER
     411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

Show »
Length:640
Mass (Da):72,780
Checksum:i272AB99BBE391B42
GO
Isoform 3 (identifier: Q96KR4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

Show »
Length:692
Mass (Da):78,111
Checksum:i3000E53236452C1D
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WCE5F8WCE5_HUMAN
Leishmanolysin-like peptidase
LMLN
603Annotation score:
C9JF40C9JF40_HUMAN
Leishmanolysin-like peptidase
LMLN
151Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti539R → K in CAP49203 (PubMed:19706689).Curated1
Sequence conflicti539R → K in CAP49204 (PubMed:19706689).Curated1
Sequence conflicti539R → K in CAC42882 (Ref. 2) Curated1
Sequence conflicti539R → K in CAC42883 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_060158106E → D. Corresponds to variant dbSNP:rs7373165Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0280021 – 73MVTTL…PSDTE → MGRRSGLLGLRPGPEPVALE R in isoform 2. 2 PublicationsAdd BLAST73
Alternative sequenceiVSP_028003411G → GWYKANYSMAEKLDWGRGMG CDFVRKSCKFWIDQQRQK in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM920777 mRNA Translation: CAP49203.1
AM920778 mRNA Translation: CAP49204.1
AJ312398 mRNA Translation: CAC42882.1
AJ312399 mRNA Translation: CAC42883.1
AC135893 Genomic DNA No translation available.
CCDSiCCDS3332.1 [Q96KR4-1]
CCDS46988.1 [Q96KR4-3]
RefSeqiNP_001129521.2, NM_001136049.2 [Q96KR4-3]
NP_149018.2, NM_033029.3 [Q96KR4-1]
UniGeneiHs.518540

Genome annotation databases

EnsembliENST00000330198; ENSP00000328829; ENSG00000185621 [Q96KR4-1]
ENST00000420910; ENSP00000410926; ENSG00000185621 [Q96KR4-3]
ENST00000482695; ENSP00000418324; ENSG00000185621 [Q96KR4-2]
GeneIDi89782
KEGGihsa:89782
UCSCiuc003fyt.4 human [Q96KR4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM920777 mRNA Translation: CAP49203.1
AM920778 mRNA Translation: CAP49204.1
AJ312398 mRNA Translation: CAC42882.1
AJ312399 mRNA Translation: CAC42883.1
AC135893 Genomic DNA No translation available.
CCDSiCCDS3332.1 [Q96KR4-1]
CCDS46988.1 [Q96KR4-3]
RefSeqiNP_001129521.2, NM_001136049.2 [Q96KR4-3]
NP_149018.2, NM_033029.3 [Q96KR4-1]
UniGeneiHs.518540

3D structure databases

ProteinModelPortaliQ96KR4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124601, 11 interactors

Protein family/group databases

MEROPSiM08.003

PTM databases

iPTMnetiQ96KR4
PhosphoSitePlusiQ96KR4

Polymorphism and mutation databases

BioMutaiLMLN
DMDMi296434578

Proteomic databases

EPDiQ96KR4
PeptideAtlasiQ96KR4
PRIDEiQ96KR4
ProteomicsDBi77106
77107 [Q96KR4-2]

Protocols and materials databases

DNASUi89782
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000330198; ENSP00000328829; ENSG00000185621 [Q96KR4-1]
ENST00000420910; ENSP00000410926; ENSG00000185621 [Q96KR4-3]
ENST00000482695; ENSP00000418324; ENSG00000185621 [Q96KR4-2]
GeneIDi89782
KEGGihsa:89782
UCSCiuc003fyt.4 human [Q96KR4-1]

Organism-specific databases

CTDi89782
DisGeNETi89782
EuPathDBiHostDB:ENSG00000185621.11
GeneCardsiLMLN
HGNCiHGNC:15991 LMLN
HPAiHPA016481
HPA028844
MIMi609380 gene
neXtProtiNX_Q96KR4
OpenTargetsiENSG00000185621
PharmGKBiPA30402
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000008796
HOGENOMiHOG000007103
HOVERGENiHBG087499
InParanoidiQ96KR4
KOiK13539
OMAiGWLHKGA
OrthoDBiEOG091G03XZ
PhylomeDBiQ96KR4
TreeFamiTF315265

Miscellaneous databases

GenomeRNAii89782
PROiPR:Q96KR4
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000185621 Expressed in 187 organ(s), highest expression level in prostate gland
CleanExiHS_LMLN
ExpressionAtlasiQ96KR4 baseline and differential
GenevisibleiQ96KR4 HS

Family and domain databases

InterProiView protein in InterPro
IPR001577 Peptidase_M8
PANTHERiPTHR10942 PTHR10942, 2 hits
PfamiView protein in Pfam
PF01457 Peptidase_M8, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiLMLN_HUMAN
AccessioniPrimary (citable) accession number: Q96KR4
Secondary accession number(s): B3LDG9
, B3LDH0, C9J796, F8WB28, Q96KR5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: May 18, 2010
Last modified: November 7, 2018
This is version 124 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again