Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (16 Oct 2019)
Sequence version 2 (24 Nov 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

TNFAIP3-interacting protein 3

Gene

TNIP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processInflammatory response

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5689896 Ovarian tumor domain proteases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TNFAIP3-interacting protein 3
Alternative name(s):
A20-binding inhibitor of NF-kappa-B activation 3
Short name:
ABIN-3
Listeria-induced gene protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNIP3Imported
Synonyms:ABIN3, LIND
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19315 TNIP3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608019 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96KP6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi214 – 215ER → AA: Abolishes ubiquitin binding; loss of inhibitory activity on NF-kappa-B activation. 1 Publication2

Organism-specific databases

DisGeNET

More...
DisGeNETi
79931

Open Targets

More...
OpenTargetsi
ENSG00000050730

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134934429

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96KP6

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TNIP3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
269849474

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000726071 – 325TNFAIP3-interacting protein 3Add BLAST325

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96KP6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96KP6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96KP6

PeptideAtlas

More...
PeptideAtlasi
Q96KP6

PRoteomics IDEntifications database

More...
PRIDEi
Q96KP6

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
5265
5641
77100 [Q96KP6-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96KP6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96KP6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in lung, lymph node, thymus and fetal liver. Expressed at lower levels in bone marrow, brain, kidney, spleen, leukocytes and tonsils. Could be detected in heart, salivary gland, adrenal gland, pancreas, ovary and fetal brain. High levels detected in liver, colon, small intestine, muscle, stomach, testis, placenta, thyroid, uterus, prostate, skin and PBL.2 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By Listeria infection. Expression is slightly down-regulated by dexamethasone and slightly up-regulated by IL-10. Strongly induced mRNA and protein expression by lipopolysaccharide.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000050730 Expressed in 68 organ(s), highest expression level in frontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96KP6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96KP6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043063

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TNFAIP3.

Interacts with polyubiquitin.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123006, 12 interactors

Protein interaction database and analysis system

More...
IntActi
Q96KP6, 37 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000426613

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96KP6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni190 – 248Ubiquitin-binding domain (UBD)Add BLAST59

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili27 – 265Sequence analysisAdd BLAST239

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGHG Eukaryota
ENOG410YIE3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000046908

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000013050

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96KP6

Identification of Orthologs from Complete Genome Data

More...
OMAi
QWDHQFR

Database of Orthologous Groups

More...
OrthoDBi
701614at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96KP6

TreeFam database of animal gene trees

More...
TreeFami
TF351138

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032419 CC2-LZ_dom
IPR033574 TNIP3

The PANTHER Classification System

More...
PANTHERi
PTHR31882:SF2 PTHR31882:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16516 CC2-LZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96KP6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAHFVQGTSR MIAAESSTEH KECAEPSTRK NLMNSLEQKI RCLEKQRKEL
60 70 80 90 100
LEVNQQWDQQ FRSMKELYER KVAELKTKLD AAERFLSTRE KDPHQRQRKD
110 120 130 140 150
DRQREDDRQR DLTRDRLQRE EKEKERLNEE LHELKEENKL LKGKNTLANK
160 170 180 190 200
EKEHYECEIK RLNKALQDAL NIKCSFSEDC LRKSRVEFCH EEMRTEMEVL
210 220 230 240 250
KQQVQIYEED FKKERSDRER LNQEKEELQQ INETSQSQLN RLNSQIKACQ
260 270 280 290 300
MEKEKLEKQL KQMYCPPCNC GLVFHLQDPW VPTGPGAVQK QREHPPDYQW
310 320
YALDQLPPDV QHKANGLSSV KKVHP
Length:325
Mass (Da):38,943
Last modified:November 24, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC03EDCCA38B59D29
GO
Isoform 2 (identifier: Q96KP6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNKNEKHDDKLVMFTNQSEDSERCESMELDKKIQDLIERNASPHPKRFTPEAMPTHRNLCSLKTPGKTASM
     296-325: PDYQWYALDQLPPDVQHKANGLSSVKKVHP → VYPQ

Show »
Length:369
Mass (Da):44,085
Checksum:iC6A8CE357D9379B5
GO
Isoform 3 (identifier: Q96KP6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIPCGWLMNK...LKTPGKTASM
     296-325: PDYQWYALDQLPPDVQHKANGLSSVKKVHP → VYPQ

Show »
Length:376
Mass (Da):44,886
Checksum:i71F05AE911BAC6EA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y9J7H0Y9J7_HUMAN
TNFAIP3-interacting protein 3
TNIP3
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15018 differs from that shown. Reason: Frameshift.Curated
The sequence BAB15018 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAC85929 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti109Q → H in AAI28409 (PubMed:15489334).Curated1
Sequence conflicti298Y → C in AAL02151 (PubMed:11345586).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05700699K → E. Corresponds to variant dbSNP:rs10000692Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451011M → MNKNEKHDDKLVMFTNQSED SERCESMELDKKIQDLIERN ASPHPKRFTPEAMPTHRNLC SLKTPGKTASM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0451021M → MIPCGWLMNKNEKHDDKLVM FTNQSEDSERCESMELDKKI QDLIERNASPHPKRFTPEAM PTHRNLCSLKTPGKTASM in isoform 3. 1 Publication1
Alternative sequenceiVSP_045103296 – 325PDYQW…KKVHP → VYPQ in isoform 2 and isoform 3. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF277289 mRNA Translation: AAL02151.1
AJ320534 mRNA Translation: CAC85929.1 Frameshift.
AK024815 mRNA Translation: BAB15018.1 Sequence problems.
AK290409 mRNA Translation: BAF83098.1
AK301058 mRNA Translation: BAG62667.1
AK303192 mRNA Translation: BAG64285.1
AC105254 Genomic DNA No translation available.
AC108027 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX05264.1
BC128408 mRNA Translation: AAI28409.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3718.1 [Q96KP6-1]
CCDS58925.1 [Q96KP6-2]
CCDS58926.1 [Q96KP6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001122315.2, NM_001128843.2 [Q96KP6-2]
NP_001231693.1, NM_001244764.1 [Q96KP6-3]
NP_079149.3, NM_024873.5 [Q96KP6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000057513; ENSP00000057513; ENSG00000050730 [Q96KP6-1]
ENST00000507879; ENSP00000427106; ENSG00000050730 [Q96KP6-2]
ENST00000509841; ENSP00000426613; ENSG00000050730 [Q96KP6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79931

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79931

UCSC genome browser

More...
UCSCi
uc010ing.4 human [Q96KP6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277289 mRNA Translation: AAL02151.1
AJ320534 mRNA Translation: CAC85929.1 Frameshift.
AK024815 mRNA Translation: BAB15018.1 Sequence problems.
AK290409 mRNA Translation: BAF83098.1
AK301058 mRNA Translation: BAG62667.1
AK303192 mRNA Translation: BAG64285.1
AC105254 Genomic DNA No translation available.
AC108027 Genomic DNA No translation available.
CH471056 Genomic DNA Translation: EAX05264.1
BC128408 mRNA Translation: AAI28409.1
CCDSiCCDS3718.1 [Q96KP6-1]
CCDS58925.1 [Q96KP6-2]
CCDS58926.1 [Q96KP6-3]
RefSeqiNP_001122315.2, NM_001128843.2 [Q96KP6-2]
NP_001231693.1, NM_001244764.1 [Q96KP6-3]
NP_079149.3, NM_024873.5 [Q96KP6-1]

3D structure databases

SMRiQ96KP6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123006, 12 interactors
IntActiQ96KP6, 37 interactors
STRINGi9606.ENSP00000426613

PTM databases

iPTMnetiQ96KP6
PhosphoSitePlusiQ96KP6

Polymorphism and mutation databases

BioMutaiTNIP3
DMDMi269849474

Proteomic databases

EPDiQ96KP6
MassIVEiQ96KP6
PaxDbiQ96KP6
PeptideAtlasiQ96KP6
PRIDEiQ96KP6
ProteomicsDBi5265
5641
77100 [Q96KP6-1]

Genome annotation databases

EnsembliENST00000057513; ENSP00000057513; ENSG00000050730 [Q96KP6-1]
ENST00000507879; ENSP00000427106; ENSG00000050730 [Q96KP6-2]
ENST00000509841; ENSP00000426613; ENSG00000050730 [Q96KP6-3]
GeneIDi79931
KEGGihsa:79931
UCSCiuc010ing.4 human [Q96KP6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79931
DisGeNETi79931

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TNIP3
HGNCiHGNC:19315 TNIP3
HPAiHPA043063
MIMi608019 gene
neXtProtiNX_Q96KP6
OpenTargetsiENSG00000050730
PharmGKBiPA134934429

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGHG Eukaryota
ENOG410YIE3 LUCA
GeneTreeiENSGT00510000046908
HOGENOMiHOG000013050
InParanoidiQ96KP6
OMAiQWDHQFR
OrthoDBi701614at2759
PhylomeDBiQ96KP6
TreeFamiTF351138

Enzyme and pathway databases

ReactomeiR-HSA-5689896 Ovarian tumor domain proteases

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79931
PharosiQ96KP6

Protein Ontology

More...
PROi
PR:Q96KP6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000050730 Expressed in 68 organ(s), highest expression level in frontal cortex
ExpressionAtlasiQ96KP6 baseline and differential
GenevisibleiQ96KP6 HS

Family and domain databases

InterProiView protein in InterPro
IPR032419 CC2-LZ_dom
IPR033574 TNIP3
PANTHERiPTHR31882:SF2 PTHR31882:SF2, 1 hit
PfamiView protein in Pfam
PF16516 CC2-LZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNIP3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96KP6
Secondary accession number(s): A1A574
, A8K2Z4, B4DVF5, B4E023, Q96PQ3, Q9H780
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: November 24, 2009
Last modified: October 16, 2019
This is version 109 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again