Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96KN8 (PLAT5_HUMAN)

Entry version 118 (31 Jul 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Phospholipase A and acyltransferase 5

Gene

PLAAT5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:22825852, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed:22825852). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19000777, PubMed:22825852).1 Publication2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei145By similarity1
Active sitei157By similarity1
Active sitei233Acyl-thioester intermediateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Hydrolase, Transferase

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1482839 Acyl chain remodelling of PE

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001126

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phospholipase A and acyltransferase 5Imported
Alternative name(s):
Ca(2+)-independent N-acyltransferase1 Publication (EC:2.3.1.-2 Publications, EC:3.1.1.322 Publications, EC:3.1.1.42 Publications)
Short name:
iNAT1 Publication
H-rev107-like protein 5
HRAS-like suppressor 5
Short name:
HRSL5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLAAT5Combined sources
Synonyms:HRASLS5, HRLP5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:24978 PLAAT5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611474 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96KN8

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000168004

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142671672

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HRASLS5

Domain mapping of disease mutations (DMDM)

More...DMDMi		296434533

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001524881 – 279Phospholipase A and acyltransferase 5Add BLAST279

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96KN8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96KN8

PeptideAtlas

More...PeptideAtlasi		Q96KN8

PRoteomics IDEntifications database

More...PRIDEi		Q96KN8

ProteomicsDB human proteome resource

More...ProteomicsDBi		24961
26717
77095 [Q96KN8-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96KN8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression level in testis and pancreas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000168004 Expressed in 134 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96KN8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96KN8 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		125580, 6 interactors

Protein interaction database and analysis system

More...IntActi		Q96KN8, 4 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000301790

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96KN8

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the H-rev107 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410J8WF Eukaryota
ENOG4111DRT LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162436

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000134692

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96KN8

KEGG Orthology (KO)

More...KOi		K23278

Identification of Orthologs from Complete Genome Data

More...OMAi		TKKMVNK

Database of Orthologous Groups

More...OrthoDBi		1602481at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96KN8

TreeFam database of animal gene trees

More...TreeFami		TF330836

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007053 LRAT_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04970 LRAT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96KN8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLSPGAEGE YALRLPRIPP PLPKPASRTA STGPKDQPPA LRRSAVPHSG 
        60         70         80         90        100
LNSISPLELE ESVGFAALVQ LPAKQPPPGT LEQGRSIQQG EKAVVSLETT 
       110        120        130        140        150
PSQKADWSSI PKPENEGKLI KQAAEGKPRP RPGDLIEIFR IGYEHWAIYV 
       160        170        180        190        200
EDDCVVHLAP PSEEFEVGSI TSIFSNRAVV KYSRLEDVLH GCSWKVNNKL 
       210        220        230        240        250
DGTYLPLPVD KIIQRTKKMV NKIVQYSLIE GNCEHFVNGL RYGVPRSQQV 
       260        270 
EHALMEGAKA AGAVISAVVD SIKPKPITA
Length:279
Mass (Da):30,312
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF388449962CA8E3D
GO
Isoform 2 (identifier: Q96KN8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     234-279: EHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA → RARPDGRSEGCWSSYFSCSG

Note: No experimental confirmation available.
Show »
Length:253
Mass (Da):27,677
Checksum:i2605CF3AFEA24C34
GO
Isoform 3 (identifier: Q96KN8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-59: Missing.

Note: No experimental confirmation available.
Show »
Length:269
Mass (Da):29,288
Checksum:iD6C3D0D8AF0917D7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BYL7H7BYL7_HUMAN
Phospholipase A and acyltransferase...
PLAAT5
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YGT7H0YGT7_HUMAN
Phospholipase A and acyltransferase...
PLAAT5
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4Q3F5H4Q3_HUMAN
Phospholipase A and acyltransferase...
PLAAT5
19Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04947731S → G3 PublicationsCorresponds to variant dbSNP:rs10897424Ensembl.1
Natural variantiVAR_02448693A → P. Corresponds to variant dbSNP:rs940611Ensembl.1
Natural variantiVAR_049478214Q → R. Corresponds to variant dbSNP:rs35735923Ensembl.1
Natural variantiVAR_049479258A → V. Corresponds to variant dbSNP:rs35375575Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04582550 – 59Missing in isoform 3. Curated10
Alternative sequenceiVSP_045826234 – 279EHFVN…KPITA → RARPDGRSEGCWSSYFSCSG in isoform 2. CuratedAdd BLAST46

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AB298804 mRNA Translation: BAH08633.1
AJ416558 mRNA Translation: CAC94942.1
AP000484 Genomic DNA No translation available.
AP001591 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74150.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53646.1 [Q96KN8-3]
CCDS53647.1 [Q96KN8-2]
CCDS8044.1 [Q96KN8-1]

NCBI Reference Sequences

More...RefSeqi		NP_473449.1, NM_054108.3 [Q96KN8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000301790; ENSP00000301790; ENSG00000168004 [Q96KN8-1]
ENST00000539221; ENSP00000443873; ENSG00000168004 [Q96KN8-2]
ENST00000540857; ENSP00000444809; ENSG00000168004 [Q96KN8-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		117245

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:117245

UCSC genome browser

More...UCSCi		uc001nwy.3 human [Q96KN8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB298804 mRNA Translation: BAH08633.1
AJ416558 mRNA Translation: CAC94942.1
AP000484 Genomic DNA No translation available.
AP001591 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74150.1
CCDSiCCDS53646.1 [Q96KN8-3]
CCDS53647.1 [Q96KN8-2]
CCDS8044.1 [Q96KN8-1]
RefSeqiNP_473449.1, NM_054108.3 [Q96KN8-1]

3D structure databases

SMRiQ96KN8
ModBaseiSearch...

Protein-protein interaction databases

BioGridi125580, 6 interactors
IntActiQ96KN8, 4 interactors
STRINGi9606.ENSP00000301790

Chemistry databases

SwissLipidsiSLP:000001126

PTM databases

iPTMnetiQ96KN8

Polymorphism and mutation databases

BioMutaiHRASLS5
DMDMi296434533

Proteomic databases

jPOSTiQ96KN8
PaxDbiQ96KN8
PeptideAtlasiQ96KN8
PRIDEiQ96KN8
ProteomicsDBi24961
26717
77095 [Q96KN8-1]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		117245
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301790; ENSP00000301790; ENSG00000168004 [Q96KN8-1]
ENST00000539221; ENSP00000443873; ENSG00000168004 [Q96KN8-2]
ENST00000540857; ENSP00000444809; ENSG00000168004 [Q96KN8-3]
GeneIDi117245
KEGGihsa:117245
UCSCiuc001nwy.3 human [Q96KN8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		117245

GeneCards: human genes, protein and diseases

More...GeneCardsi		HRASLS5
HGNCiHGNC:24978 PLAAT5
MIMi611474 gene
neXtProtiNX_Q96KN8
OpenTargetsiENSG00000168004
PharmGKBiPA142671672

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410J8WF Eukaryota
ENOG4111DRT LUCA
GeneTreeiENSGT00940000162436
HOGENOMiHOG000134692
InParanoidiQ96KN8
KOiK23278
OMAiTKKMVNK
OrthoDBi1602481at2759
PhylomeDBiQ96KN8
TreeFamiTF330836

Enzyme and pathway databases

ReactomeiR-HSA-1482839 Acyl chain remodelling of PE

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HRASLS5 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		117245

Protein Ontology

More...PROi		PR:Q96KN8

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000168004 Expressed in 134 organ(s), highest expression level in testis
ExpressionAtlasiQ96KN8 baseline and differential
GenevisibleiQ96KN8 HS

Family and domain databases

InterProiView protein in InterPro
IPR007053 LRAT_dom
PfamiView protein in Pfam
PF04970 LRAT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLAT5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96KN8
Secondary accession number(s): B7X6T1, F5GZ87, F5H4Y9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: May 18, 2010
Last modified: July 31, 2019
This is version 118 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again