Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ca(2+)-independent N-acyltransferase

Gene

HRASLS5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

catalyzes N-acylation of phosphatidylethanolamine (PE) to generate N-Acylphosphatidylethanolamine (NAPE) a precursor of bioactive N-acylethanolamines, including the endocannabinoid anandamide.1 Publication

GO - Molecular functioni

  • N-acyltransferase activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionAcyltransferase, Transferase

Enzyme and pathway databases

ReactomeiR-HSA-1482839 Acyl chain remodelling of PE

Chemistry databases

SwissLipidsiSLP:000001126

Names & Taxonomyi

Protein namesi
Recommended name:
Ca(2+)-independent N-acyltransferase (EC:2.3.1.-)
Short name:
iNAT
Alternative name(s):
H-rev107-like protein 5
HRAS-like suppressor 5
Short name:
HRSL5
Gene namesi
Name:HRASLS5
Synonyms:HRLP5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000168004.9
HGNCiHGNC:24978 HRASLS5
MIMi611474 gene
neXtProtiNX_Q96KN8

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000168004
PharmGKBiPA142671672

Polymorphism and mutation databases

BioMutaiHRASLS5
DMDMi296434533

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001524881 – 279Ca(2+)-independent N-acyltransferaseAdd BLAST279

Proteomic databases

PaxDbiQ96KN8
PeptideAtlasiQ96KN8
PRIDEiQ96KN8
ProteomicsDBi77095

PTM databases

iPTMnetiQ96KN8

Expressioni

Tissue specificityi

Highest expression level in testis and pancreas.

Gene expression databases

BgeeiENSG00000168004 Expressed in 134 organ(s), highest expression level in testis
CleanExiHS_HRASLS5
ExpressionAtlasiQ96KN8 baseline and differential
GenevisibleiQ96KN8 HS

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi125580, 6 interactors
IntActiQ96KN8, 4 interactors
STRINGi9606.ENSP00000301790

Structurei

3D structure databases

ProteinModelPortaliQ96KN8
SMRiQ96KN8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the H-rev107 family.Curated

Phylogenomic databases

eggNOGiENOG410J8WF Eukaryota
ENOG4111DRT LUCA
GeneTreeiENSGT00390000013327
HOGENOMiHOG000134692
HOVERGENiHBG051926
InParanoidiQ96KN8
OMAiTKKMVNK
OrthoDBiEOG091G08MK
PhylomeDBiQ96KN8
TreeFamiTF330836

Family and domain databases

InterProiView protein in InterPro
IPR007053 LRAT-like_dom
PfamiView protein in Pfam
PF04970 LRAT, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96KN8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGLSPGAEGE YALRLPRIPP PLPKPASRTA STGPKDQPPA LRRSAVPHSG
60 70 80 90 100
LNSISPLELE ESVGFAALVQ LPAKQPPPGT LEQGRSIQQG EKAVVSLETT
110 120 130 140 150
PSQKADWSSI PKPENEGKLI KQAAEGKPRP RPGDLIEIFR IGYEHWAIYV
160 170 180 190 200
EDDCVVHLAP PSEEFEVGSI TSIFSNRAVV KYSRLEDVLH GCSWKVNNKL
210 220 230 240 250
DGTYLPLPVD KIIQRTKKMV NKIVQYSLIE GNCEHFVNGL RYGVPRSQQV
260 270
EHALMEGAKA AGAVISAVVD SIKPKPITA
Length:279
Mass (Da):30,312
Last modified:May 18, 2010 - v2
Checksum:iF388449962CA8E3D
GO
Isoform 2 (identifier: Q96KN8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     234-279: EHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA → RARPDGRSEGCWSSYFSCSG

Note: No experimental confirmation available.
Show »
Length:253
Mass (Da):27,677
Checksum:i2605CF3AFEA24C34
GO
Isoform 3 (identifier: Q96KN8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-59: Missing.

Note: No experimental confirmation available.
Show »
Length:269
Mass (Da):29,288
Checksum:iD6C3D0D8AF0917D7
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YGT7H0YGT7_HUMAN
Ca(2+)-independent N-acyltransferas...
HRASLS5
49Annotation score:
F5H4Q3F5H4Q3_HUMAN
Ca(2+)-independent N-acyltransferas...
HRASLS5
19Annotation score:
H7BYL7H7BYL7_HUMAN
Ca(2+)-independent N-acyltransferas...
HRASLS5
37Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04947731S → G3 PublicationsCorresponds to variant dbSNP:rs10897424Ensembl.1
Natural variantiVAR_02448693A → P. Corresponds to variant dbSNP:rs940611Ensembl.1
Natural variantiVAR_049478214Q → R. Corresponds to variant dbSNP:rs35735923Ensembl.1
Natural variantiVAR_049479258A → V. Corresponds to variant dbSNP:rs35375575Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04582550 – 59Missing in isoform 3. Curated10
Alternative sequenceiVSP_045826234 – 279EHFVN…KPITA → RARPDGRSEGCWSSYFSCSG in isoform 2. CuratedAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB298804 mRNA Translation: BAH08633.1
AJ416558 mRNA Translation: CAC94942.1
AP000484 Genomic DNA No translation available.
AP001591 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74150.1
CCDSiCCDS53646.1 [Q96KN8-3]
CCDS53647.1 [Q96KN8-2]
CCDS8044.1 [Q96KN8-1]
RefSeqiNP_473449.1, NM_054108.3
UniGeneiHs.410316

Genome annotation databases

EnsembliENST00000301790; ENSP00000301790; ENSG00000168004 [Q96KN8-1]
ENST00000539221; ENSP00000443873; ENSG00000168004 [Q96KN8-2]
ENST00000540857; ENSP00000444809; ENSG00000168004 [Q96KN8-3]
GeneIDi117245
KEGGihsa:117245
UCSCiuc001nwy.3 human [Q96KN8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB298804 mRNA Translation: BAH08633.1
AJ416558 mRNA Translation: CAC94942.1
AP000484 Genomic DNA No translation available.
AP001591 Genomic DNA No translation available.
CH471076 Genomic DNA Translation: EAW74150.1
CCDSiCCDS53646.1 [Q96KN8-3]
CCDS53647.1 [Q96KN8-2]
CCDS8044.1 [Q96KN8-1]
RefSeqiNP_473449.1, NM_054108.3
UniGeneiHs.410316

3D structure databases

ProteinModelPortaliQ96KN8
SMRiQ96KN8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125580, 6 interactors
IntActiQ96KN8, 4 interactors
STRINGi9606.ENSP00000301790

Chemistry databases

SwissLipidsiSLP:000001126

PTM databases

iPTMnetiQ96KN8

Polymorphism and mutation databases

BioMutaiHRASLS5
DMDMi296434533

Proteomic databases

PaxDbiQ96KN8
PeptideAtlasiQ96KN8
PRIDEiQ96KN8
ProteomicsDBi77095

Protocols and materials databases

DNASUi117245
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301790; ENSP00000301790; ENSG00000168004 [Q96KN8-1]
ENST00000539221; ENSP00000443873; ENSG00000168004 [Q96KN8-2]
ENST00000540857; ENSP00000444809; ENSG00000168004 [Q96KN8-3]
GeneIDi117245
KEGGihsa:117245
UCSCiuc001nwy.3 human [Q96KN8-1]

Organism-specific databases

CTDi117245
EuPathDBiHostDB:ENSG00000168004.9
GeneCardsiHRASLS5
HGNCiHGNC:24978 HRASLS5
MIMi611474 gene
neXtProtiNX_Q96KN8
OpenTargetsiENSG00000168004
PharmGKBiPA142671672
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J8WF Eukaryota
ENOG4111DRT LUCA
GeneTreeiENSGT00390000013327
HOGENOMiHOG000134692
HOVERGENiHBG051926
InParanoidiQ96KN8
OMAiTKKMVNK
OrthoDBiEOG091G08MK
PhylomeDBiQ96KN8
TreeFamiTF330836

Enzyme and pathway databases

ReactomeiR-HSA-1482839 Acyl chain remodelling of PE

Miscellaneous databases

ChiTaRSiHRASLS5 human
GenomeRNAii117245
PROiPR:Q96KN8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168004 Expressed in 134 organ(s), highest expression level in testis
CleanExiHS_HRASLS5
ExpressionAtlasiQ96KN8 baseline and differential
GenevisibleiQ96KN8 HS

Family and domain databases

InterProiView protein in InterPro
IPR007053 LRAT-like_dom
PfamiView protein in Pfam
PF04970 LRAT, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiHRSL5_HUMAN
AccessioniPrimary (citable) accession number: Q96KN8
Secondary accession number(s): B7X6T1, F5GZ87, F5H4Y9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 31, 2002
Last sequence update: May 18, 2010
Last modified: November 7, 2018
This is version 111 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again