Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (05 Jun 2019)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

PDZ and LIM domain protein 2

Gene

PDLIM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin binding Source: GO_Central
  • metal ion binding Source: UniProtKB-KW
  • muscle alpha-actinin binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PDZ and LIM domain protein 2
Alternative name(s):
PDZ-LIM protein mystique
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PDLIM2
ORF Names:PP6345
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13992 PDLIM2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609722 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96JY6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi80L → K: Abolishes cell adhesion to collagen and ability to suppress anchorage independent growth. 1 Publication1
Mutagenesisi313C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-316. 1 Publication1
Mutagenesisi316C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-313. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
64236

Open Targets

More...
OpenTargetsi
ENSG00000120913

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33159

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PDLIM2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
67461069

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758621 – 352PDZ and LIM domain protein 2Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei124PhosphoserineCombined sources1
Modified residuei126PhosphothreonineCombined sources1
Modified residuei127PhosphoserineBy similarity1
Modified residuei129PhosphoserineCombined sources1
Modified residuei134PhosphoserineBy similarity1
Modified residuei137PhosphoserineCombined sources1
Modified residuei143PhosphoserineBy similarity1
Modified residuei161PhosphoserineCombined sources1
Modified residuei197PhosphoserineCombined sources1
Modified residuei203PhosphoserineBy similarity1
Modified residuei213PhosphoserineBy similarity1
Modified residuei266PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96JY6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96JY6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96JY6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96JY6

PeptideAtlas

More...
PeptideAtlasi
Q96JY6

PRoteomics IDEntifications database

More...
PRIDEi
Q96JY6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
77017
77018 [Q96JY6-2]
77019 [Q96JY6-3]
77020 [Q96JY6-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96JY6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96JY6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120913 Expressed in 225 organ(s), highest expression level in spleen

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96JY6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96JY6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003880

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with alpha-actinins ACTN1 and ACTN4, FLNA and MYH9.By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
ACDQ96AP02EBI-9057264,EBI-717666

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122122, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q96JY6, 12 interactors

Molecular INTeraction database

More...
MINTi
Q96JY6

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000312634

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1352
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96JY6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q96JY6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 84PDZPROSITE-ProRule annotationAdd BLAST84
Domaini284 – 344LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST61

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi114 – 161Ser-richAdd BLAST48

Keywords - Domaini

LIM domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1703 Eukaryota
ENOG410XRD4 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160418

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000290704

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96JY6

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQSLAHS

Database of Orthologous Groups

More...
OrthoDBi
840552at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96JY6

TreeFam database of animal gene trees

More...
TreeFami
TF106408

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR031847 DUF4749
IPR001478 PDZ
IPR036034 PDZ_sf
IPR001781 Znf_LIM

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15936 DUF4749, 1 hit
PF00412 LIM, 1 hit
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132 LIM, 1 hit
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96JY6-1) [UniParc]FASTAAdd to basket
Also known as: Mystique 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALTVDVAGP APWGFRITGG RDFHTPIMVT KVAERGKAKD ADLRPGDIIV
60 70 80 90 100
AINGESAEGM LHAEAQSKIR QSPSPLRLQL DRSQATSPGQ TNGDSSLEVL
110 120 130 140 150
ATRFQGSVRT YTESQSSLRS SYSSPTSLSP RAGSPFSPPP SSSSLTGEAA
160 170 180 190 200
ISRSFQSLAC SPGLPAADRL SYSGRPGSRQ AGLGRAGDSA VLVLPPSPGP
210 220 230 240 250
RSSRPSMDSE GGSLLLDEDS EVFKMLQENR EGRAAPRQSS SFRLLQEALE
260 270 280 290 300
AEERGGTPAF LPSSLSPQSS LPASRALATP PKLHTCEKCS TSIANQAVRI
310 320 330 340 350
QEGRYRHPGC YTCADCGLNL KMRGHFWVGD ELYCEKHARQ RYSAPATLSS

RA
Length:352
Mass (Da):37,459
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE36EC66C61C5E9DB
GO
Isoform 2 (identifier: Q96JY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-224: SFQSLACSPG...LLDEDSEVFK → RRPRPRWRLG...LSALAGSPGG
     225-352: Missing.

Note: No experimental confirmation available.
Show »
Length:224
Mass (Da):23,073
Checksum:iF4C39E4F01144F52
GO
Isoform 3 (identifier: Q96JY6-3) [UniParc]FASTAAdd to basket
Also known as: Mystique 1

The sequence of this isoform differs from the canonical sequence as follows:
     328-352: VGDELYCEKHARQRYSAPATLSSRA → EDACAMEGMRLSLEALEGMVEGAKRRDRRKTRRPIQPSW

Show »
Length:366
Mass (Da):39,181
Checksum:i739E0BB65889B1F6
GO
Isoform 4 (identifier: Q96JY6-4) [UniParc]FASTAAdd to basket
Also known as: Mystique 3

The sequence of this isoform differs from the canonical sequence as follows:
     256-352: GTPAFLPSSL...SAPATLSSRA → TRLCASRRAGTATPAATPVPTVG

Show »
Length:278
Mass (Da):29,105
Checksum:iF3D480E6DEAD66E9
GO
Isoform 5 (identifier: Q96JY6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRGGRARPAW...AESTDRLKGM

Show »
Length:602
Mass (Da):62,746
Checksum:iFCA292BEEBB24930
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WVI1A0A087WVI1_HUMAN
PDZ and LIM domain protein 2
PDLIM2
325Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3KPU0B3KPU0_HUMAN
PDZ and LIM domain protein 2
PDLIM2
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSR2C9JSR2_HUMAN
PDZ and LIM domain protein 2
PDLIM2
235Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JS55C9JS55_HUMAN
PDZ and LIM domain protein 2
PDLIM2
254Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J760C9J760_HUMAN
PDZ and LIM domain protein 2
PDLIM2
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9K0F0C9K0F0_HUMAN
PDZ and LIM domain protein 2
PDLIM2
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0X3C9J0X3_HUMAN
PDZ and LIM domain protein 2
PDLIM2
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WXJ0A0A087WXJ0_HUMAN
PDZ and LIM domain protein 2
PDLIM2
137Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUQ1A0A087WUQ1_HUMAN
PDZ and LIM domain protein 2
PDLIM2
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WFB8F8WFB8_HUMAN
PDZ and LIM domain protein 2
PDLIM2
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG16633 differs from that shown. Reason: Frameshift at position 131.Curated
The sequence AAL55747 differs from that shown. Reason: Frameshift at positions 42 and 207.Curated
The sequence AAL65265 differs from that shown. Reason: Frameshift at position 237.Curated
The sequence BAB15788 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti91T → N in AAG16633 (Ref. 1) Curated1
Sequence conflicti116S → F in AAG16633 (Ref. 1) Curated1
Sequence conflicti149A → R in AAL55747 (PubMed:15498874).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0471131M → MRGGRARPAWESFMGLPPRS SAKWGAGQSLDRLCCAPGSR GLAGAPGRMRAPPAGRSQPA GGPGDSLPHPPGGLGPGGSA WARRAEAAASRARGGGRGGP GITWAEAGPGAPGGLSPESG RRQRERWRLPAFPPSRAWAP SRTGERQPGERAHLRLSARP ALPGAGLLSAPLSARNPGLV RGPAPWSLASAGAPPRAALS PAGALLLQPPARRVLCPRSE GGSRTGRAGPSGWAPPRGAR SAESTDRLKGM in isoform 5. Curated1
Alternative sequenceiVSP_014058154 – 224SFQSL…SEVFK → RRPRPRWRLGGAGAAAFPGP SFLQAQHGLGRGKPPPGRGL GSLQDAAGKSRGTGGPPTVQ LLSALAGSPGG in isoform 2. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_014059225 – 352Missing in isoform 2. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_014060256 – 352GTPAF…LSSRA → TRLCASRRAGTATPAATPVP TVG in isoform 4. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_014061328 – 352VGDEL…LSSRA → EDACAMEGMRLSLEALEGMV EGAKRRDRRKTRRPIQPSW in isoform 3. 3 PublicationsAdd BLAST25

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY007729 mRNA Translation: AAG16633.1 Frameshift.
AY070438 mRNA Translation: AAL65265.1 Frameshift.
AY217349 mRNA Translation: AAO45102.1
AF289563 mRNA Translation: AAL55747.1 Frameshift.
AK024498 mRNA Translation: BAB15788.1 Different initiation.
AK027800 mRNA Translation: BAB55378.1
AC037459 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63667.1
CH471080 Genomic DNA Translation: EAW63669.1
BC021556 mRNA Translation: AAH21556.1
BC071774 mRNA Translation: AAH71774.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34860.1 [Q96JY6-3]
CCDS34861.1 [Q96JY6-4]
CCDS6032.2 [Q96JY6-5]

NCBI Reference Sequences

More...
RefSeqi
NP_067643.3, NM_021630.5 [Q96JY6-5]
NP_789847.1, NM_176871.3 [Q96JY6-3]
NP_932159.1, NM_198042.3 [Q96JY6-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000265810; ENSP00000265810; ENSG00000120913 [Q96JY6-3]
ENST00000308354; ENSP00000312634; ENSG00000120913 [Q96JY6-5]
ENST00000339162; ENSP00000342035; ENSG00000120913 [Q96JY6-5]
ENST00000397760; ENSP00000380867; ENSG00000120913 [Q96JY6-1]
ENST00000397761; ENSP00000380868; ENSG00000120913 [Q96JY6-1]
ENST00000409141; ENSP00000386868; ENSG00000120913 [Q96JY6-4]
ENST00000409417; ENSP00000387084; ENSG00000120913 [Q96JY6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64236

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64236

UCSC genome browser

More...
UCSCi
uc003xby.5 human [Q96JY6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007729 mRNA Translation: AAG16633.1 Frameshift.
AY070438 mRNA Translation: AAL65265.1 Frameshift.
AY217349 mRNA Translation: AAO45102.1
AF289563 mRNA Translation: AAL55747.1 Frameshift.
AK024498 mRNA Translation: BAB15788.1 Different initiation.
AK027800 mRNA Translation: BAB55378.1
AC037459 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63667.1
CH471080 Genomic DNA Translation: EAW63669.1
BC021556 mRNA Translation: AAH21556.1
BC071774 mRNA Translation: AAH71774.1
CCDSiCCDS34860.1 [Q96JY6-3]
CCDS34861.1 [Q96JY6-4]
CCDS6032.2 [Q96JY6-5]
RefSeqiNP_067643.3, NM_021630.5 [Q96JY6-5]
NP_789847.1, NM_176871.3 [Q96JY6-3]
NP_932159.1, NM_198042.3 [Q96JY6-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2PA1X-ray1.70A1-82[»]
3PDVX-ray2.20A1-83[»]
SMRiQ96JY6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122122, 15 interactors
IntActiQ96JY6, 12 interactors
MINTiQ96JY6
STRINGi9606.ENSP00000312634

PTM databases

iPTMnetiQ96JY6
PhosphoSitePlusiQ96JY6

Polymorphism and mutation databases

BioMutaiPDLIM2
DMDMi67461069

Proteomic databases

EPDiQ96JY6
jPOSTiQ96JY6
MaxQBiQ96JY6
PaxDbiQ96JY6
PeptideAtlasiQ96JY6
PRIDEiQ96JY6
ProteomicsDBi77017
77018 [Q96JY6-2]
77019 [Q96JY6-3]
77020 [Q96JY6-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
64236
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265810; ENSP00000265810; ENSG00000120913 [Q96JY6-3]
ENST00000308354; ENSP00000312634; ENSG00000120913 [Q96JY6-5]
ENST00000339162; ENSP00000342035; ENSG00000120913 [Q96JY6-5]
ENST00000397760; ENSP00000380867; ENSG00000120913 [Q96JY6-1]
ENST00000397761; ENSP00000380868; ENSG00000120913 [Q96JY6-1]
ENST00000409141; ENSP00000386868; ENSG00000120913 [Q96JY6-4]
ENST00000409417; ENSP00000387084; ENSG00000120913 [Q96JY6-1]
GeneIDi64236
KEGGihsa:64236
UCSCiuc003xby.5 human [Q96JY6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64236
DisGeNETi64236

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PDLIM2
HGNCiHGNC:13992 PDLIM2
HPAiHPA003880
MIMi609722 gene
neXtProtiNX_Q96JY6
OpenTargetsiENSG00000120913
PharmGKBiPA33159

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1703 Eukaryota
ENOG410XRD4 LUCA
GeneTreeiENSGT00940000160418
HOGENOMiHOG000290704
InParanoidiQ96JY6
OMAiFQSLAHS
OrthoDBi840552at2759
PhylomeDBiQ96JY6
TreeFamiTF106408

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PDLIM2 human
EvolutionaryTraceiQ96JY6

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PDLIM2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64236

Protein Ontology

More...
PROi
PR:Q96JY6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120913 Expressed in 225 organ(s), highest expression level in spleen
ExpressionAtlasiQ96JY6 baseline and differential
GenevisibleiQ96JY6 HS

Family and domain databases

InterProiView protein in InterPro
IPR031847 DUF4749
IPR001478 PDZ
IPR036034 PDZ_sf
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF15936 DUF4749, 1 hit
PF00412 LIM, 1 hit
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 1 hit
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDLI2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JY6
Secondary accession number(s): D3DSR5
, J3KNH4, Q7Z584, Q86WM8, Q8WZ29, Q9H4L9, Q9H7I2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: December 1, 2001
Last modified: June 5, 2019
This is version 148 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again