Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 152 (31 Jul 2019)
Sequence version 3 (26 May 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein 462

Gene

ZNF462

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Zinc finger nuclear factor involved in transcription by regulating chromatin structure and organization (PubMed:20219459, PubMed:21570965). Involved in the pluripotency and differentiation of embryonic stem cells by regulating SOX2, POU5F1/OCT4, and NANOG (PubMed:21570965). By binding PBX1, prevents the heterodimerization of PBX1 and HOXA9 and their binding to DNA (By similarity). Regulates neuronal development and neural cell differentiation (PubMed:21570965).By similarity2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri4 – 27C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri108 – 131C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri162 – 185C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri439 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri470 – 492C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri600 – 623C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri843 – 866C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri886 – 908C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri925 – 948C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1030 – 1053C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1265 – 1288C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1470 – 1493C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1515 – 1538C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1577 – 1600C2H2-type 14PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1660 – 1683C2H2-type 15PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1697 – 1720C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1892 – 1914C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1968 – 1992C2H2-type 18; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri2025 – 2048C2H2-type 19PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2054 – 2077C2H2-type 20PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2083 – 2106C2H2-type 21PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2191 – 2214C2H2-type 22PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2220 – 2243C2H2-type 23PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2254 – 2276C2H2-type 24PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri2300 – 2322C2H2-type 25PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri2328 – 2351C2H2-type 26PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2414 – 2436C2H2-type 27PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 462
Alternative name(s):
Zinc finger PBX1-interacting proteinBy similarity
Short name:
ZFPIPBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF462
Synonyms:KIAA1803
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21684 ZNF462

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617371 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96JM2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
58499

MalaCards human disease database

More...
MalaCardsi
ZNF462

Open Targets

More...
OpenTargetsi
ENSG00000148143

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
502430 Metopic ridging-ptosis-facial dysmorphism syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134949139

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF462

Domain mapping of disease mutations (DMDM)

More...
DMDMi
238054352

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000476011 – 2506Zinc finger protein 462Add BLAST2506

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki234Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki271Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi292O-linked (GlcNAc6P) serine1 Publication1
Glycosylationi309O-linked (GlcNAc6P) serine1 Publication1
Cross-linki337Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki347Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki349Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei350PhosphoserineCombined sources1
Modified residuei354PhosphoserineCombined sources1
Cross-linki428Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki484Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki631Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki657Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki668Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei688PhosphoserineCombined sources1
Cross-linki706Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki986Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1090PhosphoserineCombined sources1
Cross-linki1135Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1166PhosphoserineCombined sources1
Cross-linki1206Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1214Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1220Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1243Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1499Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1571Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1591Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1698Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1780Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki1946Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei2004N6-methyllysineCombined sources1
Cross-linki2104Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei2172PhosphoserineCombined sources1
Modified residuei2177PhosphoserineCombined sources1
Cross-linki2293Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2444Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki2504Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Isoform 2 (identifier: Q96JM2-2)
Cross-linki849Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-GlcNAcylated with O-GlcNAc-6-phosphate.1 Publication

Keywords - PTMi

Glycoprotein, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96JM2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96JM2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96JM2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96JM2

PeptideAtlas

More...
PeptideAtlasi
Q96JM2

PRoteomics IDEntifications database

More...
PRIDEi
Q96JM2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76981 [Q96JM2-1]
76982 [Q96JM2-2]
76983 [Q96JM2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96JM2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96JM2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000148143 Expressed in 207 organ(s), highest expression level in forebrain

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96JM2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96JM2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA022283

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PBX1; this interaction prevents PBX1-HOXA9 heterodimer from forming and binding to DNA.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
EHMT2Q96KQ73EBI-1210359,EBI-744366

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121829, 25 interactors

Database of interacting proteins

More...
DIPi
DIP-39340N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q96JM2

Protein interaction database and analysis system

More...
IntActi
Q96JM2, 22 interactors

Molecular INTeraction database

More...
MINTi
Q96JM2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000277225

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12506
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96JM2

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q96JM2

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni215 – 241Interaction with PBX1By similarityAdd BLAST27

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri4 – 27C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri108 – 131C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri162 – 185C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri439 – 462C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri470 – 492C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri600 – 623C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri843 – 866C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri886 – 908C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri925 – 948C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1030 – 1053C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1265 – 1288C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1470 – 1493C2H2-type 12PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1515 – 1538C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1577 – 1600C2H2-type 14PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1660 – 1683C2H2-type 15PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1697 – 1720C2H2-type 16PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1892 – 1914C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri1968 – 1992C2H2-type 18; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri2025 – 2048C2H2-type 19PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2054 – 2077C2H2-type 20PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2083 – 2106C2H2-type 21PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2191 – 2214C2H2-type 22PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2220 – 2243C2H2-type 23PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2254 – 2276C2H2-type 24PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri2300 – 2322C2H2-type 25PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri2328 – 2351C2H2-type 26PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri2414 – 2436C2H2-type 27PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156411

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000049226

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96JM2

Identification of Orthologs from Complete Genome Data

More...
OMAi
GLNSMDH

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96JM2

TreeFam database of animal gene trees

More...
TreeFami
TF325534

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 34 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 3 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 9 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96JM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVLQCDGCD FRAPSYEDLK AHIQDVHTAF LQPTDVAEDN VNELRCGSVN
60 70 80 90 100
ASNQTEVEFS SIKDEFAIAE DLSGQNATSL GTGGYYGHSP GYYGQHIAAN
110 120 130 140 150
PKPTNKFFQC KFCVRYFRSK NLLIEHTRKV HGAQAEGSSS GPPVPGSLNY
160 170 180 190 200
NIMMHEGFGK VFSCQFCTYK SPRRARIIKH QKMYHKNNLK ETTAPPPAPA
210 220 230 240 250
PMPDPVVPPV SLQDPCKELP AEVVERSILE SMVKPLTKSR GNFCCEWCSY
260 270 280 290 300
QTPRRERWCD HMMKKHRSMV KILSSLRQQQ EGTNLPDVPN KSAPSPTSNS
310 320 330 340 350
TYLTMNAASR EIPNTTVSNF RGSMGNSIMR PNSSASKFSP MSYPQMKPKS
360 370 380 390 400
PHNSGLVNLT ERSRYGMTDM TNSSADLETN SMLNDSSSDE ELNEIDSENG
410 420 430 440 450
LSAMDHQTSG LSAEQLMGSD GNKLLETKGI PFRRFMNRFQ CPFCPFLTMH
460 470 480 490 500
RRSISRHIEN IHLSGKTAVY KCDECPFTCK SSLKLGAHKQ CHTGTTSDWD
510 520 530 540 550
AVNSQSESIS SSLNEGVVSY ESSSINGRKS GVMLDPLQQQ QPPQPPPPPP
560 570 580 590 600
PPPPSQPQPL QQPQPPQLQP PHQVPPQPQT QPPPTQQPQP PTQAAPLHPY
610 620 630 640 650
KCTMCNYSTT TLKGLRVHQQ HKHSFCDNLP KFEGQPSSLP LENETDSHPS
660 670 680 690 700
SSNTVKKSQT SILGLSSKNN FVAKASRKLA NDFPLDLSPV KKRTRIDEIA
710 720 730 740 750
SNLQSKINQT KQQEDAVINV EDDEEEEEDN EVEIEVELDR EEEPTEPIIE
760 770 780 790 800
VPTSFSAQQI WVRDTSEPQK EPNFRNITHD YNATNGAEIE LTLSEDEEDY
810 820 830 840 850
YGSSTNLKDH QVSNTALLNT QTPIYGTEHN SENTDFGDSG RLYYCKHCDF
860 870 880 890 900
NNKSARSVST HYQRMHPYIK FSFRYILDPN DHSAVYRCLE CYIDYTNFED
910 920 930 940 950
LQQHYGEHHP EAMNVLNFDH SDLIYRCRFC SYTSPNVRSL MPHYQRMHPT
960 970 980 990 1000
VKINNAMIFS SYVVEQQEGL NTESQTLREI LNSAPKNMAT STPVARGGGL
1010 1020 1030 1040 1050
PATFNKNTPK TFTPECENQK DPLVNTVVVY DCDVCSFASP NMHSVLVHYQ
1060 1070 1080 1090 1100
KKHPEEKASY FRIQKTMRMV SVDRGSALSQ LSFEVGAPMS PKMSNMGSPP
1110 1120 1130 1140 1150
PPQPPPPDLS TELYYCKHCS YSNRSVVGVL VHYQKRHPEI KVTAKYIRQA
1160 1170 1180 1190 1200
PPTAAMMRGV EGPQGSPRPP APIQQLNRSS SERDGPPVEN EMFFCQHCDY
1210 1220 1230 1240 1250
GNRTVKGVLI HYQKKHRDFK ANADVIRQHT ATIRSLCDRN QKKPASCVLV
1260 1270 1280 1290 1300
SPSNLERDKT KLRALKCRQC SYTSPYFYAL RKHIKKDHPA LKATVTSIMR
1310 1320 1330 1340 1350
WAFLDGLIEA GYHCEWCIYS HTEPNGLLLH YQRRHPEHYV DYTYMATKLW
1360 1370 1380 1390 1400
AGPDPSPPSL TMPAEAKTYR CRDCVFEAVS IWDITNHYQA FHPWAMNGDE
1410 1420 1430 1440 1450
SVLLDIIKEK DAVEKPILSS EELAGPVNCE NSIPTPFPEQ EAECPEDARL
1460 1470 1480 1490 1500
SPEKSLQLAS ANPAISSTPY QCTVCQSEYN NLHGLLTHYG KKHPGMKVKA
1510 1520 1530 1540 1550
ADFAQDIDIN PGAVYKCRHC PYINTRIHGV LTHYQKRHPS IKVTAEDFVH
1560 1570 1580 1590 1600
DVEQSADISQ NDVEETSRIF KQGYGAYRCK LCPYTHGTLE KLKIHYEKYH
1610 1620 1630 1640 1650
NQPEFDVFSQ SPPKLPVPLE PEMTTEVSPS QVSITEEEVG EEPVSTSHFS
1660 1670 1680 1690 1700
TSHLVSHTVF RCQLCKYFCS TRKGIARHYR IKHNNVRAQP EGKNNLFKCA
1710 1720 1730 1740 1750
LCAYTNPIRK GLAAHYQKRH DIDAYYTHCL AASRTISDKP NKVIIPSPPK
1760 1770 1780 1790 1800
DDSPQLSEEL RRAVEKKKCS LCSFQSFSKK GIVSHYMKRH PGVFPKKQHA
1810 1820 1830 1840 1850
SKLGGYFTAV YADEHEKPTL MEEEERGNFE KAEVEGEAQE IEWLPFRCIK
1860 1870 1880 1890 1900
CFKLSFSTAE LLCMHYTDHH SRDLKRDFII LGNGPRLQNS TYQCKHCDSK
1910 1920 1930 1940 1950
LQSTAELTSH LNIHNEEFQK RAKRQERRKQ LLSKQKYADG AFADFKQERP
1960 1970 1980 1990 2000
FGHLEEVPKI KERKVVGYKC KFCVEVHPTL RAICNHLRKH VQYGNVPAVS
2010 2020 2030 2040 2050
AAVKGLRSHE RSHLALAMFT REDKYSCQYC SFVSAFRHNL DRHMQTHHGH
2060 2070 2080 2090 2100
HKPFRCKLCS FKSSYNSRLK THILKAHAGE HAYKCSWCSF STMTISQLKE
2110 2120 2130 2140 2150
HSLKVHGKAL TLPRPRIVSL LSSHSHHSSQ KATPAEEVED SNDSSYSEPP
2160 2170 2180 2190 2200
DVQQQLNHYQ SAALARNNSR VSPVPLSGAA AGTEQKTEAV LHCEFCEFSS
2210 2220 2230 2240 2250
GYIQSIRRHY RDKHGGKKLF KCKDCSFYTG FKSAFTMHVE AGHSAVPEEG
2260 2270 2280 2290 2300
PKDLRCPLCL YHTKYKRNMI DHIVLHREER VVPIEVCRSK LSKYLQGVVF
2310 2320 2330 2340 2350
RCDKCTFTCS SDESLQQHIE KHNELKPYKC QLCYYETKHT EELDSHLRDE
2360 2370 2380 2390 2400
HKVSRNFELV GRVNLDQLEQ MKEKMESSSS DDEDKEEEMN SKAEDRELMR
2410 2420 2430 2440 2450
FSDHGAALNT EKRFPCEFCG RAFSQGSEWE RHVLRHGMAL NDTKQVSREE
2460 2470 2480 2490 2500
IHPKEIMENS VKMPSIEEKE DDEAIGIDFS LKNETVAICV VTADKSLLEN

AEAKKE
Length:2,506
Mass (Da):284,688
Last modified:May 26, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBE921753A66384DB
GO
Isoform 2 (identifier: Q96JM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1155: Missing.
     2004-2004: K → KQEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ

Note: No experimental confirmation available.Combined sources
Show »
Length:1,412
Mass (Da):161,530
Checksum:i6C979F201AABC035
GO
Isoform 3 (identifier: Q96JM2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2004-2004: K → KEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ

Show »
Length:2,566
Mass (Da):291,117
Checksum:i7073E699016C8FCD
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y6H9H0Y6H9_HUMAN
Zinc finger protein 462
ZNF462
208Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BLX4H3BLX4_HUMAN
Zinc finger protein 462
ZNF462
1,449Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQU3U3KQU3_HUMAN
Zinc finger protein 462
ZNF462
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH36884 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1241Q → R in AK027866 (PubMed:14702039).Curated1
Sequence conflicti1250V → I in AK027866 (PubMed:14702039).Curated1
Sequence conflicti1332Q → R in AK027866 (PubMed:14702039).Curated1
Sequence conflicti1424A → T in AK027866 (PubMed:14702039).Curated1
Sequence conflicti1430E → A in AK027866 (PubMed:14702039).Curated1
Sequence conflicti1936K → E in AK027866 (PubMed:14702039).Curated1
Sequence conflicti2030C → S in AK027866 (PubMed:14702039).Curated1
Sequence conflicti2277Missing in AK027866 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_058301404M → V. Corresponds to variant dbSNP:rs17723637Ensembl.1
Natural variantiVAR_0583021187P → S. Corresponds to variant dbSNP:rs3814541Ensembl.1
Natural variantiVAR_0583031828N → S. Corresponds to variant dbSNP:rs3814538Ensembl.1
Natural variantiVAR_0583042052K → R. Corresponds to variant dbSNP:rs7020769Ensembl.1
Natural variantiVAR_0583052452H → L. Corresponds to variant dbSNP:rs10217192Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0374071 – 1155Missing in isoform 2. 1 PublicationAdd BLAST1155
Alternative sequenceiVSP_0374082004K → KQEADDPAHLFLDGLEAAKD ASGALVGRVDGEHCLLDGML EDETRPGGYHCSQCDRVLMS MQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_0374092004K → KEADDPAHLFLDGLEAAKDA SGALVGRVDGEHCLLDGMLE DETRPGGYHCSQCDRVLMSM Q in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB058706 mRNA Translation: BAB47432.2
AL512593 Genomic DNA No translation available.
AK027866 mRNA No translation available.
BC036884 mRNA Translation: AAH36884.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35096.1 [Q96JM2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_067047.4, NM_021224.5 [Q96JM2-1]
XP_006717278.1, XM_006717215.3 [Q96JM2-3]
XP_006717279.1, XM_006717216.3 [Q96JM2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000277225; ENSP00000277225; ENSG00000148143 [Q96JM2-1]
ENST00000441147; ENSP00000397306; ENSG00000148143 [Q96JM2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
58499

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:58499

UCSC genome browser

More...
UCSCi
uc004bcz.4 human [Q96JM2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB058706 mRNA Translation: BAB47432.2
AL512593 Genomic DNA No translation available.
AK027866 mRNA No translation available.
BC036884 mRNA Translation: AAH36884.1 Different initiation.
CCDSiCCDS35096.1 [Q96JM2-1]
RefSeqiNP_067047.4, NM_021224.5 [Q96JM2-1]
XP_006717278.1, XM_006717215.3 [Q96JM2-3]
XP_006717279.1, XM_006717216.3 [Q96JM2-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X6FNMR-A1874-1948[»]
SMRiQ96JM2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi121829, 25 interactors
DIPiDIP-39340N
ELMiQ96JM2
IntActiQ96JM2, 22 interactors
MINTiQ96JM2
STRINGi9606.ENSP00000277225

PTM databases

iPTMnetiQ96JM2
PhosphoSitePlusiQ96JM2

Polymorphism and mutation databases

BioMutaiZNF462
DMDMi238054352

Proteomic databases

EPDiQ96JM2
jPOSTiQ96JM2
MaxQBiQ96JM2
PaxDbiQ96JM2
PeptideAtlasiQ96JM2
PRIDEiQ96JM2
ProteomicsDBi76981 [Q96JM2-1]
76982 [Q96JM2-2]
76983 [Q96JM2-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
58499
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277225; ENSP00000277225; ENSG00000148143 [Q96JM2-1]
ENST00000441147; ENSP00000397306; ENSG00000148143 [Q96JM2-2]
GeneIDi58499
KEGGihsa:58499
UCSCiuc004bcz.4 human [Q96JM2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
58499
DisGeNETi58499

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF462
HGNCiHGNC:21684 ZNF462
HPAiHPA022283
MalaCardsiZNF462
MIMi617371 gene
neXtProtiNX_Q96JM2
OpenTargetsiENSG00000148143
Orphaneti502430 Metopic ridging-ptosis-facial dysmorphism syndrome
PharmGKBiPA134949139

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000156411
HOGENOMiHOG000049226
InParanoidiQ96JM2
OMAiGLNSMDH
OrthoDBi1318335at2759
PhylomeDBiQ96JM2
TreeFamiTF325534

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF462 human
EvolutionaryTraceiQ96JM2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
58499

Protein Ontology

More...
PROi
PR:Q96JM2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000148143 Expressed in 207 organ(s), highest expression level in forebrain
ExpressionAtlasiQ96JM2 baseline and differential
GenevisibleiQ96JM2 HS

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 34 hits
SUPFAMiSSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 9 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN462_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JM2
Secondary accession number(s): Q5T0T4, Q8N408
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 26, 2009
Last modified: July 31, 2019
This is version 152 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again