Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (17 Jun 2020)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

HHIP-like protein 1

Gene

HHIPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
HHIP-like protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HHIPL1
Synonyms:HHIP2, KIAA1822
ORF Names:UNQ9245/PRO34761
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000182218.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19710 HHIPL1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96JK4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84439

Open Targets

More...
OpenTargetsi
ENSG00000182218

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162390893

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96JK4 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HHIPL1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166218135

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031496220 – 782HHIP-like protein 1Add BLAST763

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi181 ↔ 521PROSITE-ProRule annotation
Disulfide bondi185 ↔ 528PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi234N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi399 ↔ 417PROSITE-ProRule annotation
Disulfide bondi484 ↔ 584PROSITE-ProRule annotation
Disulfide bondi700 ↔ 765PROSITE-ProRule annotation
Disulfide bondi713 ↔ 775PROSITE-ProRule annotation
Disulfide bondi745 ↔ 755PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96JK4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96JK4

PeptideAtlas

More...
PeptideAtlasi
Q96JK4

PRoteomics IDEntifications database

More...
PRIDEi
Q96JK4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76977 [Q96JK4-1]
76978 [Q96JK4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96JK4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96JK4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182218 Expressed in dorsolateral prefrontal cortex and 84 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96JK4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96JK4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000182218 Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124078, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q96JK4, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000330601

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96JK4 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96JK4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini673 – 776SRCRPROSITE-ProRule annotationAdd BLAST104

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the HHIP family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IE87 Eukaryota
COG2133 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162083

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_012344_2_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96JK4

Identification of Orthologs from Complete Genome Data

More...
OMAi
EICMGTG

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96JK4

TreeFam database of animal gene trees

More...
TreeFami
TF329059

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.120.10.30, 1 hit
3.10.250.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR018143 Folate_rcpt-like
IPR012938 Glc/Sorbosone_DH
IPR011041 Quinoprot_gluc/sorb_DH
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03024 Folate_rec, 1 hit
PF07995 GSDH, 1 hit
PF00530 SRCR, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00258 SPERACTRCPTR

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00202 SR, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50952 SSF50952, 1 hit
SSF56487 SSF56487, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00420 SRCR_1, 1 hit
PS50287 SRCR_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96JK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARARAGALL ALWVLGAAAH PQCLDFRPPF RPTQPLRLCA QYSDFGCCDE
60 70 80 90 100
GRDAELTRRF WALASRVDAA EWAACAGYAR DLLCQECSPY AAHLYDAEDP
110 120 130 140 150
FTPLRTVPGL CQDYCLDMWH KCRGLFRHLS TDQELWALEG NLARFCRYLS
160 170 180 190 200
LDDTDYCFPY LLVNKNLNSN LGHVVADAKG CLQLCLEEVA NGLRNPVAMV
210 220 230 240 250
HARDGTHRFF VAEQVGLVWA YLPDRSRLGK PFLNISRVVL TSPWEGDERG
260 270 280 290 300
FLGIAFHPSF QHNRRLYVYY SVGIRSSEWI RISEFRVSED DENAVDHSSE
310 320 330 340 350
RIILEVKEPA SNHNGGQLLF GDDGYLYIFT GDGGMAGDPF GTFGNAQNKS
360 370 380 390 400
ALLGKVLRID VDRKERGLPY GIPPDNPFVG DPAAQPEVYA LGVRNMWRCS
410 420 430 440 450
FDRGDPSSGT GRGRLFCGDV GQNKFEEVDV VERGGNYGWR AREGFECYDR
460 470 480 490 500
SLCANTSLND LLPIFAYPHT VGKSVTGGYV YRGCEYPNLN GLYIFGDFMS
510 520 530 540 550
GRLMSLQENP GTGQWQYSEI CMGHGQTCEF PGLINNYYPY IISFGEDEAG
560 570 580 590 600
ELYFMSTGEP SATAPRGVVY KIIDASRRAP PGKCQIQPAQ VKIRSRLIPF
610 620 630 640 650
VPKEKFIPKT RSTPRPTARA PTRAPRRGRP TAAPPAPTPR PARPTQQPGS
660 670 680 690 700
RRGGGRRRGR LNSASRAFRD GEVRLVRPAG LSSGSGRVEV FVGGRWGTVC
710 720 730 740 750
DDSWNISGAA VVCRQLGFAY AVRAVKRAEF GQGGSLPILL DDVRCAGWER
760 770 780
NLLECQHNGV GTHNCEHDED AGVVCSHQNP DL
Length:782
Mass (Da):86,731
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5A6170845C6F9472
GO
Isoform 2 (identifier: Q96JK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     577-608: RRAPPGKCQIQPAQVKIRSRLIPFVPKEKFIP → SCKARSAMPGYVPAPSVCSSLTSQPFILQWWK
     609-782: Missing.

Show »
Length:608
Mass (Da):67,881
Checksum:i3FC5CDF759808D6B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti151L → M in AAQ88540 (PubMed:12975309).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_060163692V → A. Corresponds to variant dbSNP:rs7158073Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_030455577 – 608RRAPP…EKFIP → SCKARSAMPGYVPAPSVCSS LTSQPFILQWWK in isoform 2. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_030456609 – 782Missing in isoform 2. 2 PublicationsAdd BLAST174

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358173 mRNA Translation: AAQ88540.1
AL160313 Genomic DNA No translation available.
BC132877 mRNA Translation: AAI32878.1
BC136577 mRNA Translation: AAI36578.1
AB058725 mRNA Translation: BAB47451.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45162.1 [Q96JK4-1]
CCDS9953.1 [Q96JK4-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001120730.1, NM_001127258.2 [Q96JK4-1]
NP_115801.3, NM_032425.5 [Q96JK4-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000330710; ENSP00000330601; ENSG00000182218 [Q96JK4-1]
ENST00000357223; ENSP00000349757; ENSG00000182218 [Q96JK4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84439

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84439

UCSC genome browser

More...
UCSCi
uc001ygl.2 human [Q96JK4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358173 mRNA Translation: AAQ88540.1
AL160313 Genomic DNA No translation available.
BC132877 mRNA Translation: AAI32878.1
BC136577 mRNA Translation: AAI36578.1
AB058725 mRNA Translation: BAB47451.1
CCDSiCCDS45162.1 [Q96JK4-1]
CCDS9953.1 [Q96JK4-2]
RefSeqiNP_001120730.1, NM_001127258.2 [Q96JK4-1]
NP_115801.3, NM_032425.5 [Q96JK4-2]

3D structure databases

SMRiQ96JK4
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124078, 9 interactors
IntActiQ96JK4, 3 interactors
STRINGi9606.ENSP00000330601

PTM databases

iPTMnetiQ96JK4
PhosphoSitePlusiQ96JK4

Polymorphism and mutation databases

BioMutaiHHIPL1
DMDMi166218135

Proteomic databases

MassIVEiQ96JK4
PaxDbiQ96JK4
PeptideAtlasiQ96JK4
PRIDEiQ96JK4
ProteomicsDBi76977 [Q96JK4-1]
76978 [Q96JK4-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
57719 53 antibodies

Genome annotation databases

EnsembliENST00000330710; ENSP00000330601; ENSG00000182218 [Q96JK4-1]
ENST00000357223; ENSP00000349757; ENSG00000182218 [Q96JK4-2]
GeneIDi84439
KEGGihsa:84439
UCSCiuc001ygl.2 human [Q96JK4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84439
DisGeNETi84439
EuPathDBiHostDB:ENSG00000182218.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HHIPL1
HGNCiHGNC:19710 HHIPL1
HPAiENSG00000182218 Tissue enhanced (brain)
neXtProtiNX_Q96JK4
OpenTargetsiENSG00000182218
PharmGKBiPA162390893

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IE87 Eukaryota
COG2133 LUCA
GeneTreeiENSGT00940000162083
HOGENOMiCLU_012344_2_3_1
InParanoidiQ96JK4
OMAiEICMGTG
PhylomeDBiQ96JK4
TreeFamiTF329059

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84439 3 hits in 780 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HHIPL1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84439
PharosiQ96JK4 Tdark

Protein Ontology

More...
PROi
PR:Q96JK4
RNActiQ96JK4 protein

Gene expression databases

BgeeiENSG00000182218 Expressed in dorsolateral prefrontal cortex and 84 other tissues
ExpressionAtlasiQ96JK4 baseline and differential
GenevisibleiQ96JK4 HS

Family and domain databases

Gene3Di2.120.10.30, 1 hit
3.10.250.10, 1 hit
InterProiView protein in InterPro
IPR011042 6-blade_b-propeller_TolB-like
IPR018143 Folate_rcpt-like
IPR012938 Glc/Sorbosone_DH
IPR011041 Quinoprot_gluc/sorb_DH
IPR001190 SRCR
IPR017448 SRCR-like_dom
IPR036772 SRCR-like_dom_sf
PfamiView protein in Pfam
PF03024 Folate_rec, 1 hit
PF07995 GSDH, 1 hit
PF00530 SRCR, 1 hit
PRINTSiPR00258 SPERACTRCPTR
SMARTiView protein in SMART
SM00202 SR, 1 hit
SUPFAMiSSF50952 SSF50952, 1 hit
SSF56487 SSF56487, 1 hit
PROSITEiView protein in PROSITE
PS00420 SRCR_1, 1 hit
PS50287 SRCR_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHIPL1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JK4
Secondary accession number(s): A2RUF8, B2RN09, Q6UXX2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: June 17, 2020
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again