Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 124 (18 Sep 2019)
Sequence version 3 (23 Oct 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Syndetin

Gene

VPS50

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as component of the EARP complex that is involved in endocytic recycling. The EARP complex associates with Rab4-positive endosomes and promotes recycling of internalized transferrin receptor (TFRC) to the plasma membrane. Within the EARP complex, required to tether the complex to recycling endosomes. Not involved in retrograde transport from early and late endosomes to the trans-Golgi network (TGN).1 Publication

Miscellaneous

Was named 'syndetin' after the Greek 'syndeo', which means 'connect' or 'tether'.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • SNARE binding Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Syndetin1 Publication
Alternative name(s):
Coiled-coil domain-containing protein 132Curated
EARP/GARPII complex subunit VPS50Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:VPS50Imported
Synonyms:CCDC132, KIAA18611 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25956 VPS50

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616465 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96JG6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000004766

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162381332

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
VPS50

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160019079

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003072651 – 964SyndetinAdd BLAST964

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei15PhosphoserineCombined sources1
Modified residuei494PhosphoserineCombined sources1
Modified residuei498PhosphoserineCombined sources1
Modified residuei559PhosphoserineCombined sources1
Modified residuei561PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki963Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki963Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96JG6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96JG6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96JG6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96JG6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96JG6

PeptideAtlas

More...
PeptideAtlasi
Q96JG6

PRoteomics IDEntifications database

More...
PRIDEi
Q96JG6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
26988
76956 [Q96JG6-1]
76957 [Q96JG6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96JG6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96JG6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous, with higher expression in brain and skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000004766 Expressed in 203 organ(s), highest expression level in stomach

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96JG6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96JG6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA026679

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the endosome-associated retrograde protein (EARP) complex, composed of VPS51, VPS52, VPS53 and VPS50/Syndetin (PubMed:25799061, PubMed:27440922). The EARP complex interacts with EIPR1 (PubMed:27440922).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120750, 67 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q96JG6

Database of interacting proteins

More...
DIPi
DIP-61628N

Protein interaction database and analysis system

More...
IntActi
Q96JG6, 36 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000307666

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili82 – 105Sequence analysisAdd BLAST24
Coiled coili216 – 244Sequence analysisAdd BLAST29

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the syndetin family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2939 Eukaryota
ENOG410XS88 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000003442

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230787

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96JG6

KEGG Orthology (KO)

More...
KOi
K23288

Identification of Orthologs from Complete Genome Data

More...
OMAi
AKVKWDV

Database of Orthologous Groups

More...
OrthoDBi
293145at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96JG6

TreeFam database of animal gene trees

More...
TreeFami
TF106152

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019514 Syndetin_C
IPR040047 VPS50
IPR019515 VPS54_N

The PANTHER Classification System

More...
PANTHERi
PTHR13258 PTHR13258, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10474 DUF2451, 1 hit
PF10475 Vps54_N, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96JG6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQKIKSLMTR QGLKSPQESL SDLGAIESLR VPGKEEFREL REQPSDPQAE
60 70 80 90 100
QELINSIEQV YFSVDSFDIV KYELEKLPPV LNLQELEAYR DKLKQQQAAV
110 120 130 140 150
SKKVADLILE KQPAYVKELE RVTSLQTGLQ LAAVICTNGR RHLNIAKEGF
160 170 180 190 200
TQASLGLLAN QRKRQLLIGL LKSLRTIKTL QRTDVRLSEM LEEEDYPGAI
210 220 230 240 250
QLCLECQKAA STFKHYSCIS ELNSKLQDTL EQIEEQLDVA LSKICKNFDI
260 270 280 290 300
NHYTKVQQAY RLLGKTQTAM DQLHMHFTQA IHNTVFQVVL GYVELCAGNT
310 320 330 340 350
DTKFQKLQYK DLCTHVTPDS YIPCLADLCK ALWEVMLSYY RTMEWHEKHD
360 370 380 390 400
NEDTASASEG SNMIGTEETN FDRGYIKKKL EHGLTRIWQD VQLKVKTYLL
410 420 430 440 450
GTDLSIFKYD DFIFVLDIIS RLMQVGEEFC GSKSEVLQES IRKQSVNYFK
460 470 480 490 500
NYHRTRLDEL RMFLENETWE LCPVKSNFSI LQLHEFKFME QSRSPSVSPS
510 520 530 540 550
KQPVSTSSKT VTLFEQYCSG GNPFEIQANH KDEETEDVLA SNGYESDEQE
560 570 580 590 600
KSAYQEYDSD SDVPEELKRD YVDEQTGDGP VKSVSRETLK SRKKSDYSLN
610 620 630 640 650
KVNAPILTNT TLNVIRLVGK YMQMMNILKP IAFDVIHFMS QLFDYYLYAI
660 670 680 690 700
YTFFGRNDSL ESTGLGLSSS RLRTTLNRIQ ESLIDLEVSA DPTATLTAAE
710 720 730 740 750
ERKEKVPSPH LSHLVVLTSG DTLYGLAERV VATESLVFLA EQFEFLQPHL
760 770 780 790 800
DAVMPAVKKP FLQQFYSQTV STASELRKPI YWIVAGKALD YEQMLLLMAN
810 820 830 840 850
VKWDVKEIMS QHNIYVDALL KEFEQFNRRL NEVSKRVRIP LPVSNILWEH
860 870 880 890 900
CIRLANRTIV EGYANVKKCS NEGRALMQLD FQQFLMKLEK LTDIRPIPDK
910 920 930 940 950
EFVETYIKAY YLTENDMERW IKEHREYSTK QLTNLVNVCL GSHINKKARQ
960
KLLAAIDDID RPKR
Length:964
Mass (Da):111,174
Last modified:October 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2C748490DDBCBAD5
GO
Isoform 2 (identifier: Q96JG6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-327: HVTPDSYIPCLAD → VCSDLITIHISLL
     328-964: Missing.

Show »
Length:327
Mass (Da):37,259
Checksum:iB2E9D603F5DEBFE2
GO
Isoform 3 (identifier: Q96JG6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGK → MLTL

Note: No experimental confirmation available.
Show »
Length:934
Mass (Da):107,923
Checksum:i0BF781F226FB22C2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JA29C9JA29_HUMAN
Syndetin
VPS50
189Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y7Q2H0Y7Q2_HUMAN
Syndetin
VPS50
469Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZP1H7BZP1_HUMAN
Syndetin
VPS50
155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WDT1F8WDT1_HUMAN
Syndetin
VPS50
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F2Z3F0F2Z3F0_HUMAN
Syndetin
VPS50
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IRQ5A0A3B3IRQ5_HUMAN
Syndetin
VPS50
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15701 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB47490 differs from that shown. Reason: Frameshift at position 2.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti96Q → H in BAG54334 (PubMed:14702039).Curated1
Sequence conflicti670Missing in BAB15701 (PubMed:14702039).Curated1
Sequence conflicti812H → Y in BAB15701 (PubMed:14702039).Curated1
Sequence conflicti926E → K in BAB15701 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0455721 – 34MQKIK…RVPGK → MLTL in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_028658315 – 327HVTPD…PCLAD → VCSDLITIHISLL in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_028659328 – 964Missing in isoform 2. 1 PublicationAdd BLAST637

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB058764 mRNA Translation: BAB47490.2 Frameshift.
AB100163 mRNA Translation: BAI52922.1
AK027234 mRNA Translation: BAB15701.1 Different initiation.
AK126478 mRNA Translation: BAG54334.1
AC002379 Genomic DNA No translation available.
AC002453 Genomic DNA Translation: AAS02023.1
CH236949 Genomic DNA Translation: EAL24143.1
CH471091 Genomic DNA Translation: EAW76816.1
CH471091 Genomic DNA Translation: EAW76818.1
BC108708 mRNA Translation: AAI08709.1
BC017888 mRNA Translation: AAH17888.1
BC132740 mRNA Translation: AAI32741.1
BC132742 mRNA Translation: AAI32743.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43617.1 [Q96JG6-1]
CCDS5630.1 [Q96JG6-2]
CCDS59065.1 [Q96JG6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001244927.1, NM_001257998.1 [Q96JG6-3]
NP_060137.2, NM_017667.3 [Q96JG6-1]
NP_078829.1, NM_024553.2 [Q96JG6-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000251739; ENSP00000251739; ENSG00000004766 [Q96JG6-2]
ENST00000305866; ENSP00000307666; ENSG00000004766 [Q96JG6-1]
ENST00000544910; ENSP00000443104; ENSG00000004766 [Q96JG6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55610

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55610

UCSC genome browser

More...
UCSCi
uc003umn.4 human [Q96JG6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB058764 mRNA Translation: BAB47490.2 Frameshift.
AB100163 mRNA Translation: BAI52922.1
AK027234 mRNA Translation: BAB15701.1 Different initiation.
AK126478 mRNA Translation: BAG54334.1
AC002379 Genomic DNA No translation available.
AC002453 Genomic DNA Translation: AAS02023.1
CH236949 Genomic DNA Translation: EAL24143.1
CH471091 Genomic DNA Translation: EAW76816.1
CH471091 Genomic DNA Translation: EAW76818.1
BC108708 mRNA Translation: AAI08709.1
BC017888 mRNA Translation: AAH17888.1
BC132740 mRNA Translation: AAI32741.1
BC132742 mRNA Translation: AAI32743.1
CCDSiCCDS43617.1 [Q96JG6-1]
CCDS5630.1 [Q96JG6-2]
CCDS59065.1 [Q96JG6-3]
RefSeqiNP_001244927.1, NM_001257998.1 [Q96JG6-3]
NP_060137.2, NM_017667.3 [Q96JG6-1]
NP_078829.1, NM_024553.2 [Q96JG6-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi120750, 67 interactors
CORUMiQ96JG6
DIPiDIP-61628N
IntActiQ96JG6, 36 interactors
STRINGi9606.ENSP00000307666

PTM databases

iPTMnetiQ96JG6
PhosphoSitePlusiQ96JG6

Polymorphism and mutation databases

BioMutaiVPS50
DMDMi160019079

Proteomic databases

EPDiQ96JG6
jPOSTiQ96JG6
MassIVEiQ96JG6
MaxQBiQ96JG6
PaxDbiQ96JG6
PeptideAtlasiQ96JG6
PRIDEiQ96JG6
ProteomicsDBi26988
76956 [Q96JG6-1]
76957 [Q96JG6-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55610
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000251739; ENSP00000251739; ENSG00000004766 [Q96JG6-2]
ENST00000305866; ENSP00000307666; ENSG00000004766 [Q96JG6-1]
ENST00000544910; ENSP00000443104; ENSG00000004766 [Q96JG6-3]
GeneIDi55610
KEGGihsa:55610
UCSCiuc003umn.4 human [Q96JG6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55610

GeneCards: human genes, protein and diseases

More...
GeneCardsi
VPS50
HGNCiHGNC:25956 VPS50
HPAiHPA026679
MIMi616465 gene
neXtProtiNX_Q96JG6
OpenTargetsiENSG00000004766
PharmGKBiPA162381332

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2939 Eukaryota
ENOG410XS88 LUCA
GeneTreeiENSGT00390000003442
HOGENOMiHOG000230787
InParanoidiQ96JG6
KOiK23288
OMAiAKVKWDV
OrthoDBi293145at2759
PhylomeDBiQ96JG6
TreeFamiTF106152

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
VPS50 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
FLJ20097_/_CCDC132

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55610

Pharos

More...
Pharosi
Q96JG6

Protein Ontology

More...
PROi
PR:Q96JG6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000004766 Expressed in 203 organ(s), highest expression level in stomach
ExpressionAtlasiQ96JG6 baseline and differential
GenevisibleiQ96JG6 HS

Family and domain databases

InterProiView protein in InterPro
IPR019514 Syndetin_C
IPR040047 VPS50
IPR019515 VPS54_N
PANTHERiPTHR13258 PTHR13258, 1 hit
PfamiView protein in Pfam
PF10474 DUF2451, 1 hit
PF10475 Vps54_N, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVPS50_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JG6
Secondary accession number(s): B3KX22
, D1MQ00, F5H5U7, Q75N07, Q8WVK3, Q9H5C6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: September 18, 2019
This is version 124 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again