Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 125 (07 Oct 2020)
Sequence version 2 (01 Jul 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Protein transport protein Sec16B

Gene

SEC16B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays a role in the organization of the endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus (PubMed:17192411, PubMed:21768384, PubMed:22355596). Involved in peroxisome biogenesis. Regulates the transport of peroxisomal biogenesis factors PEX3 and PEX16 from the ER to peroxisomes (PubMed:21768384).1 Publication2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processER-Golgi transport, Peroxisome biogenesis, Protein transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q96JE7

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-204005, COPII-mediated vesicle transport

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q96JE7

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein transport protein Sec16B
Alternative name(s):
Leucine zipper transcription regulator 2
Regucalcin gene promoter region-related protein p117
Short name:
RGPR-p117
SEC16 homolog B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEC16B
Synonyms:KIAA1928, LZTR2, RGPR, SEC16S
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000120341.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30301, SEC16B

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612855, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96JE7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
89866

Open Targets

More...
OpenTargetsi
ENSG00000120341

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162402680

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96JE7, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SEC16B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
193806482

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003419741 – 1060Protein transport protein Sec16BAdd BLAST1060

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei55PhosphoserineCombined sources1
Modified residuei143PhosphoserineBy similarity1
Modified residuei167PhosphoserineCombined sources1
Modified residuei188PhosphoserineBy similarity1
Modified residuei191PhosphoserineBy similarity1
Modified residuei254PhosphoserineCombined sources1
Modified residuei258PhosphoserineCombined sources1
Modified residuei858PhosphothreonineCombined sources1
Modified residuei868PhosphoserineBy similarity1
Modified residuei871PhosphoserineBy similarity1
Modified residuei874PhosphoserineBy similarity1
Modified residuei882PhosphoserineBy similarity1
Modified residuei883PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96JE7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96JE7

PeptideAtlas

More...
PeptideAtlasi
Q96JE7

PRoteomics IDEntifications database

More...
PRIDEi
Q96JE7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
76948 [Q96JE7-1]
76949 [Q96JE7-2]
76950 [Q96JE7-3]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q96JE7-1 [Q96JE7-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96JE7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96JE7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000120341, Expressed in right lobe of liver and 114 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96JE7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96JE7, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000120341, Group enriched (intestine, liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

SEC16A and SEC16B are each present in multiple copies in a heteromeric complex (PubMed:17192411, PubMed:22355596).

Interacts with TFG (PubMed:21478858).

Interacts with SEC13 (PubMed:22355596).

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124624, 5 interactors

Protein interaction database and analysis system

More...
IntActi
Q96JE7, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000308339

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96JE7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96JE7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni34 – 224Required for endoplasmic reticulum localizationAdd BLAST191
Regioni271 – 713Central conserved domain (CCD); required for localization to endoplasmic reticulum exit sites1 PublicationAdd BLAST443

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi88 – 126Tyr-richAdd BLAST39
Compositional biasi232 – 235Poly-Ser4

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SEC16 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1913, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160138

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_010575_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96JE7

KEGG Orthology (KO)

More...
KOi
K20353

Identification of Orthologs from Complete Genome Data

More...
OMAi
FQFMSGR

Database of Orthologous Groups

More...
OrthoDBi
235062at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96JE7

Family and domain databases

Conserved Domains Database

More...
CDDi
cd09233, ACE1-Sec16-like, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024298, ACE1_Sec16_Sec31
IPR024880, Sec16
IPR024340, Sec16_CCD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12932, Sec16, 1 hit
PF12931, Sec16_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96JE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELWAPQRLP QTRGKATAPS KDPDRGFRRD GHHRPVPHSW HNGERFHQWQ
60 70 80 90 100
DNRGSPQPQQ EPRADHQQQP HYASRPGDWH QPVSGVDYYE GGYRNQLYSR
110 120 130 140 150
PGYENSYQSY QSPTMREEYA YGSYYYHGHP QWLQEERVPR QRSPYIWHED
160 170 180 190 200
YREQKYLDEH HYENQHSPFG TNSETHFQSN SRNPCKDSPA SNSGQEWPGE
210 220 230 240 250
LFPGSLLAEA QKNKPSLASE SNLLQQRESG LSSSSYELSQ YIRDAPERDD
260 270 280 290 300
PPASAAWSPV QADVSSAGPK APMKFYIPHV PVSFGPGGQL VHVGPSSPTD
310 320 330 340 350
GQAALVELHS MEVILNDSEE QEEMRSFSGP LIREDVHKVD IMTFCQQKAA
360 370 380 390 400
QSCKSETLGS RDSALLWQLL VLLCRQNGSM VGSDIAELLM QDCKKLEKYK
410 420 430 440 450
RQPPVANLIN LTDEDWPVLS SGTPNLLTGE IPPSVETPAQ IVEKFTRLLY
460 470 480 490 500
YGRKKEALEW AMKNHLWGHA LFLSSKMDPQ TYSWVMSGFT STLALNDPLQ
510 520 530 540 550
TLFQLMSGRI PQAATCCGEK QWGDWRPHLA VILSNQAGDP ELYQRAIVAI
560 570 580 590 600
GDTLAGKGLV EAAHFCYLMA HVPFGHYTVK TDHLVLLGSS HSQEFLKFAT
610 620 630 640 650
TEAIQRTEIF EYCQMLGRPK SFIPSFQVYK LLYASRLADY GLVSQALHYC
660 670 680 690 700
EAIGAAVLSQ GESSHPVLLV ELIKLAEKLK LSDPLVLERR SGDRDLEPDW
710 720 730 740 750
LAQLRRQLEQ KVAGDIGDPH PTRSDISGAG GTTTENTFYQ DFSGCQGYSE
760 770 780 790 800
APGYRSALWL TPEQTCLLQP SPQQPFPLQP GSYPAGGGAG QTGTPRPFYS
810 820 830 840 850
VPETHLPGTG SSVAVTEATG GTVWEEMLQT HLGPGENTVS QETSQPPDGQ
860 870 880 890 900
EVISKPQTPL AARPRSISES SASSAKEDEK ESSDEADKNS PRNTAQRGKL
910 920 930 940 950
GDGKEHTKSS GFGWFSWFRS KPTKNASPAG DEDSSDSPDS EETPRASSPH
960 970 980 990 1000
QAGLGLSLTP SPESPPLPDV SAFSRGRGGG EGRGSASSGG AAAGAGVGGL
1010 1020 1030 1040 1050
SGPESVSFEL CSNPGVLLPP PALKGAVPLY NPSQVPQLPT ATSLNRPNRL
1060
AQRRYPTQPC
Length:1,060
Mass (Da):116,604
Last modified:July 1, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB1D1483EAB45E676
GO
Isoform 2 (identifier: Q96JE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     592-624: SQEFLKFATTEAIQRTEIFEYCQMLGRPKSFIP → RYATWEKGNSKDIFQGTVLALVGFYGSSFHFLM
     625-1060: Missing.

Show »
Length:624
Mass (Da):70,627
Checksum:i33BFD842A0E04A94
GO
Isoform 3 (identifier: Q96JE7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-435: Missing.
     436-515: ETPAQIVEKF...MSGRIPQAAT → MRGFVHFHHA...LCRARKHRHL
     942-986: ETPRASSPHQ...RGGGEGRGSA → VGVKAEDPHP...TLVFFFLHLP
     987-1060: Missing.

Show »
Length:541
Mass (Da):59,124
Checksum:iF29B79A66232F063
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PK14E9PK14_HUMAN
Protein transport protein sec16
SEC16B
625Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YE70H0YE70_HUMAN
Protein transport protein Sec16B
SEC16B
175Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQ39U3KQ39_HUMAN
Protein transport protein Sec16B
SEC16B
316Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti134Q → R in CAI46016 (PubMed:17974005).Curated1
Sequence conflicti195Q → R in ABN42197 (PubMed:17192411).Curated1
Sequence conflicti262A → AE in CAI46016 (PubMed:17974005).Curated1
Sequence conflicti262A → AE in AAH09106 (PubMed:15489334).Curated1
Sequence conflicti514A → T in CAI46016 (PubMed:17974005).Curated1
Sequence conflicti929A → S in CAI46016 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_044130292H → R2 PublicationsCorresponds to variant dbSNP:rs12040910Ensembl.1
Natural variantiVAR_044131730G → R1 PublicationCorresponds to variant dbSNP:rs943762Ensembl.1
Natural variantiVAR_044132845Q → H1 PublicationCorresponds to variant dbSNP:rs7522194Ensembl.1
Natural variantiVAR_044133864P → A1 PublicationCorresponds to variant dbSNP:rs591120Ensembl.1
Natural variantiVAR_044134873S → N1 PublicationCorresponds to variant dbSNP:rs3813649Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0343711 – 435Missing in isoform 3. 1 PublicationAdd BLAST435
Alternative sequenceiVSP_034372436 – 515ETPAQ…PQAAT → MRGFVHFHHAAYSFLPPGGI LLPLHRPSWATWLDFLILKV AVGTRLHRVPVKIKRMCVNG LCRARKHRHL in isoform 3. 1 PublicationAdd BLAST80
Alternative sequenceiVSP_034373592 – 624SQEFL…KSFIP → RYATWEKGNSKDIFQGTVLA LVGFYGSSFHFLM in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_034374625 – 1060Missing in isoform 2. 1 PublicationAdd BLAST436
Alternative sequenceiVSP_034375942 – 986ETPRA…GRGSA → VGVKAEDPHPAGGQLRALGL EACLDQRVFPLSSAPTLVFF FLHLP in isoform 3. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_034376987 – 1060Missing in isoform 3. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB063357 mRNA Translation: BAB61035.1
EF125213 mRNA Translation: ABN42197.1
AK098627 mRNA Translation: BAC05357.1
BX647819 mRNA Translation: CAI46016.1
BC009106 mRNA Translation: AAH09106.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44281.1 [Q96JE7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_149118.2, NM_033127.2 [Q96JE7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000308284; ENSP00000308339; ENSG00000120341 [Q96JE7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
89866

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:89866

UCSC genome browser

More...
UCSCi
uc001gli.2, human [Q96JE7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB063357 mRNA Translation: BAB61035.1
EF125213 mRNA Translation: ABN42197.1
AK098627 mRNA Translation: BAC05357.1
BX647819 mRNA Translation: CAI46016.1
BC009106 mRNA Translation: AAH09106.1
CCDSiCCDS44281.1 [Q96JE7-1]
RefSeqiNP_149118.2, NM_033127.2 [Q96JE7-1]

3D structure databases

SMRiQ96JE7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124624, 5 interactors
IntActiQ96JE7, 3 interactors
STRINGi9606.ENSP00000308339

PTM databases

iPTMnetiQ96JE7
PhosphoSitePlusiQ96JE7

Polymorphism and mutation databases

BioMutaiSEC16B
DMDMi193806482

Proteomic databases

MassIVEiQ96JE7
PaxDbiQ96JE7
PeptideAtlasiQ96JE7
PRIDEiQ96JE7
ProteomicsDBi76948 [Q96JE7-1]
76949 [Q96JE7-2]
76950 [Q96JE7-3]
TopDownProteomicsiQ96JE7-1 [Q96JE7-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
35113, 116 antibodies

The DNASU plasmid repository

More...
DNASUi
89866

Genome annotation databases

EnsembliENST00000308284; ENSP00000308339; ENSG00000120341 [Q96JE7-1]
GeneIDi89866
KEGGihsa:89866
UCSCiuc001gli.2, human [Q96JE7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
89866
DisGeNETi89866
EuPathDBiHostDB:ENSG00000120341.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SEC16B
HGNCiHGNC:30301, SEC16B
HPAiENSG00000120341, Group enriched (intestine, liver)
MIMi612855, gene
neXtProtiNX_Q96JE7
OpenTargetsiENSG00000120341
PharmGKBiPA162402680

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1913, Eukaryota
GeneTreeiENSGT00940000160138
HOGENOMiCLU_010575_0_0_1
InParanoidiQ96JE7
KOiK20353
OMAiFQFMSGR
OrthoDBi235062at2759
PhylomeDBiQ96JE7

Enzyme and pathway databases

PathwayCommonsiQ96JE7
ReactomeiR-HSA-204005, COPII-mediated vesicle transport
SIGNORiQ96JE7

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
89866, 1 hit in 867 CRISPR screens

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SEC16B

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
89866
PharosiQ96JE7, Tbio

Protein Ontology

More...
PROi
PR:Q96JE7
RNActiQ96JE7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000120341, Expressed in right lobe of liver and 114 other tissues
ExpressionAtlasiQ96JE7, baseline and differential
GenevisibleiQ96JE7, HS

Family and domain databases

CDDicd09233, ACE1-Sec16-like, 1 hit
InterProiView protein in InterPro
IPR024298, ACE1_Sec16_Sec31
IPR024880, Sec16
IPR024340, Sec16_CCD
PfamiView protein in Pfam
PF12932, Sec16, 1 hit
PF12931, Sec16_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSC16B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JE7
Secondary accession number(s): A3EYF1
, Q5HYF6, Q8N7D6, Q96GX6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 1, 2008
Last modified: October 7, 2020
This is version 125 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again