Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAGUK p55 subfamily member 4

Gene

MPP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in retinal photoreceptors development.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MAGUK p55 subfamily member 4
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 5 protein
Discs large homolog 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MPP4
Synonyms:ALS2CR5, DLG6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000082126.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13680 MPP4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606575 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96JB8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
58538

MalaCards human disease database

More...
MalaCardsi
MPP4

Open Targets

More...
OpenTargetsi
ENSG00000082126

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30927

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MPP4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296438297

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000945771 – 637MAGUK p55 subfamily member 4Add BLAST637

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96JB8

PeptideAtlas

More...
PeptideAtlasi
Q96JB8

PRoteomics IDEntifications database

More...
PRIDEi
Q96JB8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
76934
76935 [Q96JB8-2]
76936 [Q96JB8-3]
76937 [Q96JB8-4]
76938 [Q96JB8-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96JB8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96JB8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the retina (at protein level). Highly expressed in the retina. Lower amounts are detected in brain, testis, ARPE-19, RPE/choroid and fetal eye. Isoform 5 is retina-specific.4 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000082126 Expressed in 61 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_MPP4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96JB8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96JB8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB079019
HPA057393

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MPDZ. May interact with GRIA2 (By similarity). Forms a complex with CRB1 and MPP5. Interacts with FASLG.By similarity2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121853, 1 interactor

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q96JB8

Protein interaction database and analysis system

More...
IntActi
Q96JB8, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000387278

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q96JB8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 80L27 1PROSITE-ProRule annotationAdd BLAST57
Domaini87 – 137L27 2PROSITE-ProRule annotationAdd BLAST51
Domaini154 – 235PDZPROSITE-ProRule annotationAdd BLAST82
Domaini242 – 312SH3PROSITE-ProRule annotationAdd BLAST71
Domaini427 – 616Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST190

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili568 – 621Sequence analysisAdd BLAST54

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Coiled coil, Repeat, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0609 Eukaryota
COG0194 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156444

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233034

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG001858

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96JB8

KEGG Orthology (KO)

More...
KOi
K21109

Identification of Orthologs from Complete Genome Data

More...
OMAi
FVDMKFK

Database of Orthologous Groups

More...
OrthoDBi
531106at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96JB8

TreeFam database of animal gene trees

More...
TreeFami
TF314263

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12034 SH3_MPP4, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR014775 L27_C
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR035600 MPP4_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF02828 L27, 1 hit
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 2 hits
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 2 hits
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96JB8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIQSDKGADP PDKKDMKLST ATNPQNGLSQ ILRLVLQELS LFYGRDVNGV
60 70 80 90 100
CLLYDLLHSP WLQALLKIYD CLQEFKEKKL VPATPHAQVL SYEVVELLRE
110 120 130 140 150
TPTSPEIQEL RQMLQAPHFK ALLSAHDTIA QKDFEPLLPP LPDNIPESEE
160 170 180 190 200
AMRIVCLVKN QQPLGATIKR HEMTGDILVA RIIHGGLAER SGLLYAGDKL
210 220 230 240 250
VEVNGVSVEG LDPEQVIHIL AMSRGTIMFK VVPVSDPPVN SQQMVYVRAM
260 270 280 290 300
TEYWPQEDPD IPCMDAGLPF QKGDILQIVD QNDALWWQAR KISDPATCAG
310 320 330 340 350
LVPSNHLLKR KQREFWWSQP YQPHTCLKST LSISMEEEDD MKIDEKCVEA
360 370 380 390 400
DEETFESEEL SEDKEEFVGY GQKFFIAGFR RSMRLCRRKS HLSPLHASVC
410 420 430 440 450
CTGSCYSAVG APYEEVVRYQ RRPSDKYRLI VLMGPSGVGV NELRRQLIEF
460 470 480 490 500
NPSHFQSAVP HTTRTKKSYE MNGREYHYVS KETFENLIYS HRMLEYGEYK
510 520 530 540 550
GHLYGTSVDA VQTVLVEGKI CVMDLEPQDI QGVRTHELKP YVIFIKPSNM
560 570 580 590 600
RCMKQSRKNA KVITDYYVDM KFKDEDLQEM ENLAQRMETQ FGQFFDHVIV
610 620 630
NDSLHDACAQ LLSAIQKAQE EPQWVPATWI SSDTESQ
Length:637
Mass (Da):72,779
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB180AE8635E32CDD
GO
Isoform 2 (identifier: Q96JB8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-257: Missing.
     332-363: SISMEEEDDMKIDEKCVEADEETFESEELSED → Y

Show »
Length:593
Mass (Da):67,565
Checksum:i2AE3ACCFDCAB8236
GO
Isoform 3 (identifier: Q96JB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-164: Missing.
     311-637: Missing.

Show »
Length:266
Mass (Da):29,771
Checksum:i4B29F97B2268AB26
GO
Isoform 4 (identifier: Q96JB8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-164: Missing.
     311-337: KQREFWWSQPYQPHTCLKSTLSISMEE → WSFALVAQAGVQWHYLDSLQPLPPGFKRFSCLSLPRSWDYI
     358-362: Missing.

Show »
Length:602
Mass (Da):68,755
Checksum:i45A4EC99FA4BB75B
GO
Isoform 5 (identifier: Q96JB8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-164: Missing.

Show »
Length:565
Mass (Da):64,600
Checksum:i4A18FB861772DBA3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WUS1A0A087WUS1_HUMAN
MAGUK p55 subfamily member 4
MPP4
606Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PG92E9PG92_HUMAN
MAGUK p55 subfamily member 4
MPP4
562Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ET46E7ET46_HUMAN
MAGUK p55 subfamily member 4
MPP4
613Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EUL8E7EUL8_HUMAN
MAGUK p55 subfamily member 4
MPP4
630Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GN59R4GN59_HUMAN
MAGUK p55 subfamily member 4
MPP4
171Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6Q0Y6F6Q0Y6_HUMAN
MAGUK p55 subfamily member 4
MPP4
579Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBH8F8WBH8_HUMAN
MAGUK p55 subfamily member 4
MPP4
434Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti5D → G in BAD18399 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02264344G → S3 PublicationsCorresponds to variant dbSNP:rs6725443Ensembl.1
Natural variantiVAR_050015562V → I. Corresponds to variant dbSNP:rs11894115Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01399193 – 164Missing in isoform 5. CuratedAdd BLAST72
Alternative sequenceiVSP_003157121 – 164Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_003159245 – 257Missing in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_003158311 – 637Missing in isoform 3. 1 PublicationAdd BLAST327
Alternative sequenceiVSP_013992311 – 337KQREF…ISMEE → WSFALVAQAGVQWHYLDSLQ PLPPGFKRFSCLSLPRSWDY I in isoform 4. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_003160332 – 363SISME…ELSED → Y in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_013993358 – 362Missing in isoform 4. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF316032 mRNA Translation: AAK71862.1
AB053302 mRNA Translation: BAB69012.1
AB053303 mRNA Translation: BAB69013.1
AK131208 mRNA Translation: BAD18399.1
AC007279 Genomic DNA Translation: AAY15057.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46491.1 [Q96JB8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_149055.1, NM_033066.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.63085

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000315506; ENSP00000319363; ENSG00000082126 [Q96JB8-2]
ENST00000409474; ENSP00000387278; ENSG00000082126 [Q96JB8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
58538

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:58538

UCSC genome browser

More...
UCSCi
uc002uyk.5 human [Q96JB8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF316032 mRNA Translation: AAK71862.1
AB053302 mRNA Translation: BAB69012.1
AB053303 mRNA Translation: BAB69013.1
AK131208 mRNA Translation: BAD18399.1
AC007279 Genomic DNA Translation: AAY15057.1
CCDSiCCDS46491.1 [Q96JB8-1]
RefSeqiNP_149055.1, NM_033066.2
UniGeneiHs.63085

3D structure databases

ProteinModelPortaliQ96JB8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121853, 1 interactor
CORUMiQ96JB8
IntActiQ96JB8, 1 interactor
STRINGi9606.ENSP00000387278

PTM databases

iPTMnetiQ96JB8
PhosphoSitePlusiQ96JB8

Polymorphism and mutation databases

BioMutaiMPP4
DMDMi296438297

Proteomic databases

PaxDbiQ96JB8
PeptideAtlasiQ96JB8
PRIDEiQ96JB8
ProteomicsDBi76934
76935 [Q96JB8-2]
76936 [Q96JB8-3]
76937 [Q96JB8-4]
76938 [Q96JB8-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
58538
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000315506; ENSP00000319363; ENSG00000082126 [Q96JB8-2]
ENST00000409474; ENSP00000387278; ENSG00000082126 [Q96JB8-1]
GeneIDi58538
KEGGihsa:58538
UCSCiuc002uyk.5 human [Q96JB8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
58538
DisGeNETi58538
EuPathDBiHostDB:ENSG00000082126.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MPP4
HGNCiHGNC:13680 MPP4
HPAiCAB079019
HPA057393
MalaCardsiMPP4
MIMi606575 gene
neXtProtiNX_Q96JB8
OpenTargetsiENSG00000082126
PharmGKBiPA30927

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0609 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00940000156444
HOGENOMiHOG000233034
HOVERGENiHBG001858
InParanoidiQ96JB8
KOiK21109
OMAiFVDMKFK
OrthoDBi531106at2759
PhylomeDBiQ96JB8
TreeFamiTF314263

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
58538

Protein Ontology

More...
PROi
PR:Q96JB8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000082126 Expressed in 61 organ(s), highest expression level in secondary oocyte
CleanExiHS_MPP4
ExpressionAtlasiQ96JB8 baseline and differential
GenevisibleiQ96JB8 HS

Family and domain databases

CDDicd12034 SH3_MPP4, 1 hit
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR014775 L27_C
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR035600 MPP4_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF02828 L27, 1 hit
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 2 hits
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 2 hits
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMPP4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JB8
Secondary accession number(s): C9IZK4
, Q53TT3, Q6ZNH6, Q96Q43, Q96Q44
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: May 18, 2010
Last modified: January 16, 2019
This is version 157 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again