Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (16 Oct 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Membrane-spanning 4-domains subfamily A member 14

Gene

MS4A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in signal transduction as a component of a multimeric receptor complex.By similarity

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.A.37.3.1 the cd20 ca(2+) channel (cd20) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Membrane-spanning 4-domains subfamily A member 14
Alternative name(s):
Testis development protein NYD-SP21
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MS4A14
Synonyms:MS4A13, MS4A16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30706 MS4A14

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96JA4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei50 – 70HelicalSequence analysisAdd BLAST21
Transmembranei76 – 96HelicalSequence analysisAdd BLAST21
Transmembranei110 – 130HelicalSequence analysisAdd BLAST21
Transmembranei141 – 161HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000166928

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162396237

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96JA4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MS4A14

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296434579

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003209671 – 679Membrane-spanning 4-domains subfamily A member 14Add BLAST679

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96JA4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96JA4

PeptideAtlas

More...
PeptideAtlasi
Q96JA4

PRoteomics IDEntifications database

More...
PRIDEi
Q96JA4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
21112
76921 [Q96JA4-1]
76922 [Q96JA4-2]
76923 [Q96JA4-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96JA4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96JA4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q96JA4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000166928 Expressed in 127 organ(s), highest expression level in sperm

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96JA4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96JA4 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q96JA4, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000433761

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi426 – 665Gln-richAdd BLAST240

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MS4A family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J0WH Eukaryota
ENOG410ZA7V LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163132

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168377

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96JA4

KEGG Orthology (KO)

More...
KOi
K22192

Identification of Orthologs from Complete Genome Data

More...
OMAi
IQFELQE

Database of Orthologous Groups

More...
OrthoDBi
969773at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96JA4

TreeFam database of animal gene trees

More...
TreeFami
TF337098

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007237 CD20-like
IPR030417 MS4A

The PANTHER Classification System

More...
PANTHERi
PTHR23320 PTHR23320, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04103 CD20, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96JA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESTSQDRRA THVITIKPNE TVLTAFPYRP HSSLLDFLKG EPRVLGATQI
60 70 80 90 100
LLALIIVGFG TIFALNYIGF SQRLPLVVLT GYPFWGALIF ILTGYLTVTD
110 120 130 140 150
KKSKLLGQGV TGMNVISSLV AITGITFTIL SYRHQDKYCQ MPSFEEICVF
160 170 180 190 200
SRTLFIVLFF LPSDVTQNSE QPAPEENDQL QFVLQEEFSS DDSTTNAQSV
210 220 230 240 250
IFGGYAFFKL TLSRSPLVSQ PGNKGREFVP DEQKQSILPS PKFSEEEIEP
260 270 280 290 300
LPPTLEKKPS ENMSIQLDST FKQMKDEDLQ SAIVQPSQMQ TKLLQDQAAS
310 320 330 340 350
LQVFPSHSAL KLEDISPEDL PSQALPVEGL SEQTMPSKST SSHVKQSSNL
360 370 380 390 400
TANDLPPQGI LSQDTSSQDM LFHDMTSQDM QSLDMLSQDT PSHAMPPQDI
410 420 430 440 450
PSQDMLSQAL SAHAILPEAS TSHIVQFPEI QHLLQQPPDL QPENTEPQNQ
460 470 480 490 500
QILQMSYQDI RSEVMEETKE WKSEEELHRR KSSRRHSLNQ QTKALQYLRR
510 520 530 540 550
HSLDVQAKGQ KSSKRHSLDQ QSKGWQSPKQ KSLDQQIKDW LSPKRHSVDK
560 570 580 590 600
QAQLNQTKEQ LPDQQAEDQQ AKGEQYPEGQ SKDGQVKDQQ TDKEQNSKKQ
610 620 630 640 650
TQDQQTEDQP AQEKKSPKGQ FQNVQAEGQQ AQVEKVPKLL CQDSESQIQQ
660 670
YQFWQFHKGN LQAGQPRTVN LLAKNPLTG
Length:679
Mass (Da):76,580
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBD523CE5C28E1207
GO
Isoform 2 (identifier: Q96JA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     90-106: Missing.

Show »
Length:662
Mass (Da):74,658
Checksum:i92F73E6A55A1D08B
GO
Isoform 3 (identifier: Q96JA4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     157-170: VLFFLPSDVTQNSE → DFILLTPPHSSHFL
     171-679: Missing.

Show »
Length:58
Mass (Da):6,710
Checksum:iB33AEBC4EF01BFA0
GO
Isoform 4 (identifier: Q96JA4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-156: I → IGILLILLIISIAELSISVTIASFRSKCWTQSDE

Show »
Length:712
Mass (Da):80,183
Checksum:iF175A1F6A04D9910
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MS57A0A0A0MS57_HUMAN
Membrane-spanning 4-domains subfami...
MS4A14
695Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRA6E9PRA6_HUMAN
Membrane-spanning 4-domains subfami...
MS4A14
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YD53H0YD53_HUMAN
Membrane-spanning 4-domains subfami...
MS4A14
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPA2E9PPA2_HUMAN
Membrane-spanning 4-domains subfami...
MS4A14
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6X344F6X344_HUMAN
Membrane-spanning 4-domains subfami...
MS4A14
567Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PIL9E9PIL9_HUMAN
Membrane-spanning 4-domains subfami...
MS4A14
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PRG6E9PRG6_HUMAN
Membrane-spanning 4-domains subfami...
MS4A14
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_039330177N → Y2 PublicationsCorresponds to variant dbSNP:rs7131283Ensembl.1
Natural variantiVAR_039331584G → R3 PublicationsCorresponds to variant dbSNP:rs3825020Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0317791 – 112Missing in isoform 3. 1 PublicationAdd BLAST112
Alternative sequenceiVSP_03178090 – 106Missing in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_056734156I → IGILLILLIISIAELSISVT IASFRSKCWTQSDE in isoform 4. Curated1
Alternative sequenceiVSP_031781157 – 170VLFFL…TQNSE → DFILLTPPHSSHFL in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_031782171 – 679Missing in isoform 3. 1 PublicationAdd BLAST509

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF367473 mRNA Translation: AAK53409.2
AY094610 mRNA Translation: AAM48587.1
AY094611 mRNA Translation: AAM48588.1
AY584610 mRNA Translation: AAV91959.1
AP003127 Genomic DNA No translation available.
BC107431 mRNA Translation: AAI07432.1
AL137391 mRNA Translation: CAB70719.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31569.1 [Q96JA4-1]
CCDS41652.1 [Q96JA4-2]
CCDS58136.1 [Q96JA4-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46450

NCBI Reference Sequences

More...
RefSeqi
NP_001073160.1, NM_001079692.2 [Q96JA4-2]
NP_001248757.1, NM_001261828.1 [Q96JA4-5]
NP_115986.3, NM_032597.4 [Q96JA4-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84689

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84689

UCSC genome browser

More...
UCSCi
uc001npj.4 human [Q96JA4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF367473 mRNA Translation: AAK53409.2
AY094610 mRNA Translation: AAM48587.1
AY094611 mRNA Translation: AAM48588.1
AY584610 mRNA Translation: AAV91959.1
AP003127 Genomic DNA No translation available.
BC107431 mRNA Translation: AAI07432.1
AL137391 mRNA Translation: CAB70719.1
CCDSiCCDS31569.1 [Q96JA4-1]
CCDS41652.1 [Q96JA4-2]
CCDS58136.1 [Q96JA4-5]
PIRiT46450
RefSeqiNP_001073160.1, NM_001079692.2 [Q96JA4-2]
NP_001248757.1, NM_001261828.1 [Q96JA4-5]
NP_115986.3, NM_032597.4 [Q96JA4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiQ96JA4, 6 interactors
STRINGi9606.ENSP00000433761

Protein family/group databases

TCDBi1.A.37.3.1 the cd20 ca(2+) channel (cd20) family

PTM databases

iPTMnetiQ96JA4
PhosphoSitePlusiQ96JA4
SwissPalmiQ96JA4

Polymorphism and mutation databases

BioMutaiMS4A14
DMDMi296434579

Proteomic databases

MassIVEiQ96JA4
PaxDbiQ96JA4
PeptideAtlasiQ96JA4
PRIDEiQ96JA4
ProteomicsDBi21112
76921 [Q96JA4-1]
76922 [Q96JA4-2]
76923 [Q96JA4-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
84689

Genome annotation databases

GeneIDi84689
KEGGihsa:84689
UCSCiuc001npj.4 human [Q96JA4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84689

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MS4A14
HGNCiHGNC:30706 MS4A14
neXtProtiNX_Q96JA4
OpenTargetsiENSG00000166928
PharmGKBiPA162396237

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J0WH Eukaryota
ENOG410ZA7V LUCA
GeneTreeiENSGT00940000163132
HOGENOMiHOG000168377
InParanoidiQ96JA4
KOiK22192
OMAiIQFELQE
OrthoDBi969773at2759
PhylomeDBiQ96JA4
TreeFamiTF337098

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84689
PharosiQ96JA4

Protein Ontology

More...
PROi
PR:Q96JA4

Gene expression databases

BgeeiENSG00000166928 Expressed in 127 organ(s), highest expression level in sperm
ExpressionAtlasiQ96JA4 baseline and differential
GenevisibleiQ96JA4 HS

Family and domain databases

InterProiView protein in InterPro
IPR007237 CD20-like
IPR030417 MS4A
PANTHERiPTHR23320 PTHR23320, 2 hits
PfamiView protein in Pfam
PF04103 CD20, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiM4A14_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JA4
Secondary accession number(s): E9PJE3
, Q2TVT5, Q3B7W3, Q86XH8, Q9NTC2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: May 18, 2010
Last modified: October 16, 2019
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again