Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96JA1 (LRIG1_HUMAN)

Entry version 158 (02 Dec 2020)
Sequence version 2 (03 Apr 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Leucine-rich repeats and immunoglobulin-like domains protein 1

Gene

LRIG1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96JA1

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-177929, Signaling by EGFR
R-HSA-6807004, Negative regulation of MET activity

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q96JA1

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q96JA1

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.43.1.21, the neat-domain containing methaemoglobin heme sequestration (n-mhs) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Leucine-rich repeats and immunoglobulin-like domains protein 1
Short name:
LIG-11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LRIG11 Publication
Synonyms:LIG1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000144749.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:17360, LRIG1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608868, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96JA1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini35 – 794ExtracellularSequence analysisAdd BLAST760
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei795 – 815HelicalSequence analysisAdd BLAST21
Topological domaini816 – 1093CytoplasmicSequence analysisAdd BLAST278

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		26018

Open Targets

More...OpenTargetsi		ENSG00000144749

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38450

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96JA1, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		LRIG1

Domain mapping of disease mutations (DMDM)

More...DMDMi		143811415

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 34Sequence analysisAdd BLAST34
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001482735 – 1093Leucine-rich repeats and immunoglobulin-like domains protein 1Add BLAST1059

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi45 ↔ 54Combined sources1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi74N-linked (GlcNAc...) asparagineSequence analysisCombined sources1 Publication1
Glycosylationi150N-linked (GlcNAc...) asparagineSequence analysisCombined sources1 Publication1
Glycosylationi246N-linked (GlcNAc...) asparagineSequence analysisCombined sources1 Publication1
Glycosylationi292N-linked (GlcNAc...) asparagineSequence analysisCombined sources1 Publication1
Glycosylationi318N-linked (GlcNAc...) asparagineSequence analysisCombined sources1 Publication1
Disulfide bondi444 ↔ 468Combined sources1 Publication
Disulfide bondi446 ↔ 489Combined sources1 Publication
Disulfide bondi516 ↔ 577PROSITE-ProRule annotationCombined sources1 Publication
Disulfide bondi620 ↔ 672PROSITE-ProRule annotationCombined sources1 Publication
Glycosylationi684N-linked (GlcNAc...) asparagineSequence analysisCombined sources1 Publication1
Disulfide bondi714 ↔ 763PROSITE-ProRule annotationCombined sources1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-1495

Encyclopedia of Proteome Dynamics

More...EPDi		Q96JA1

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96JA1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96JA1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96JA1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96JA1

PeptideAtlas

More...PeptideAtlasi		Q96JA1

PRoteomics IDEntifications database

More...PRIDEi		Q96JA1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		76916 [Q96JA1-1]
76917 [Q96JA1-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q96JA1, 9 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96JA1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96JA1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By EGF.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000144749, Expressed in pancreas and 243 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96JA1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000144749, Tissue enhanced (pancreas)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via extracellular LRR and Ig-like domains) with EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 (via extracellular domain) (PubMed:15282549). The physiological relevance of the interaction is controversial; LRIG1 may have low affinity for EGFR, and interaction may occur only when high levels of both proteins are present (PubMed:25765764).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		117489, 42 interactors

Protein interaction database and analysis system

More...IntActi		Q96JA1, 32 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000273261

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96JA1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11093
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96JA1

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini35 – 68LRRNTAdd BLAST34
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati69 – 90LRR 1Add BLAST22
Repeati93 – 114LRR 2Add BLAST22
Repeati116 – 137LRR 3Add BLAST22
Repeati140 – 161LRR 4Add BLAST22
Repeati164 – 185LRR 5Add BLAST22
Repeati189 – 210LRR 6Add BLAST22
Repeati212 – 233LRR 7Add BLAST22
Repeati236 – 257LRR 8Add BLAST22
Repeati260 – 281LRR 9Add BLAST22
Repeati284 – 305LRR 10Add BLAST22
Repeati308 – 329LRR 11Add BLAST22
Repeati332 – 353LRR 12Add BLAST22
Repeati356 – 378LRR 13Add BLAST23
Repeati383 – 404LRR 14Add BLAST22
Repeati407 – 428LRR 15Add BLAST22
Domaini440 – 491LRRCTAdd BLAST52
Domaini495 – 594Ig-like C2-type 1Add BLAST100
Domaini599 – 688Ig-like C2-type 2Add BLAST90
Domaini693 – 779Ig-like C2-type 3Add BLAST87

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi520 – 524Poly-Ser5

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains LRR and Ig-domains that can mediate low-affinity interaction with EGFR (PubMed:25765764). The LRRs and the Ig-domains are each sufficient for EGFR/ERBB1 binding. This interaction is abolished only when both the LRRs and the Ig-domains are deleted (PubMed:15282549).2 Publications

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4194, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158502

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000288_18_24_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96JA1

Identification of Orthologs from Complete Genome Data

More...OMAi		WIIEDQS

Database of Orthologous Groups

More...OrthoDBi		161719at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96JA1

TreeFam database of animal gene trees

More...TreeFami		TF325380

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 3 hits
3.80.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000483, Cys-rich_flank_reg_C
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR001611, Leu-rich_rpt
IPR003591, Leu-rich_rpt_typical-subtyp
IPR032675, LRR_dom_sf
IPR000372, LRRNT

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07679, I-set, 2 hits
PF13855, LRR_8, 5 hits
PF01463, LRRCT, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409, IG, 3 hits
SM00408, IGc2, 3 hits
SM00369, LRR_TYP, 14 hits
SM00082, LRRCT, 1 hit
SM00013, LRRNT, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 3 hits
PS51450, LRR, 14 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96JA1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARPVRGGLG APRRSPCLLL LWLLLLRLEP VTAAAGPRAP CAAACTCAGD 
        60         70         80         90        100
SLDCGGRGLA ALPGDLPSWT RSLNLSYNKL SEIDPAGFED LPNLQEVYLN 
       110        120        130        140        150
NNELTAVPSL GAASSHVVSL FLQHNKIRSV EGSQLKAYLS LEVLDLSLNN 
       160        170        180        190        200
ITEVRNTCFP HGPPIKELNL AGNRIGTLEL GAFDGLSRSL LTLRLSKNRI 
       210        220        230        240        250
TQLPVRAFKL PRLTQLDLNR NRIRLIEGLT FQGLNSLEVL KLQRNNISKL 
       260        270        280        290        300
TDGAFWGLSK MHVLHLEYNS LVEVNSGSLY GLTALHQLHL SNNSIARIHR 
       310        320        330        340        350
KGWSFCQKLH ELVLSFNNLT RLDEESLAEL SSLSVLRLSH NSISHIAEGA 
       360        370        380        390        400
FKGLRSLRVL DLDHNEISGT IEDTSGAFSG LDSLSKLTLF GNKIKSVAKR 
       410        420        430        440        450
AFSGLEGLEH LNLGGNAIRS VQFDAFVKMK NLKELHISSD SFLCDCQLKW 
       460        470        480        490        500
LPPWLIGRML QAFVTATCAH PESLKGQSIF SVPPESFVCD DFLKPQIITQ 
       510        520        530        540        550
PETTMAMVGK DIRFTCSAAS SSSSPMTFAW KKDNEVLTNA DMENFVHVHA 
       560        570        580        590        600
QDGEVMEYTT ILHLRQVTFG HEGRYQCVIT NHFGSTYSHK ARLTVNVLPS 
       610        620        630        640        650
FTKTPHDITI RTTTMARLEC AATGHPNPQI AWQKDGGTDF PAARERRMHV 
       660        670        680        690        700
MPDDDVFFIT DVKIDDAGVY SCTAQNSAGS ISANATLTVL ETPSLVVPLE 
       710        720        730        740        750
DRVVSVGETV ALQCKATGNP PPRITWFKGD RPLSLTERHH LTPDNQLLVV 
       760        770        780        790        800
QNVVAEDAGR YTCEMSNTLG TERAHSQLSV LPAAGCRKDG TTVGIFTIAV 
       810        820        830        840        850
VSSIVLTSLV WVCIIYQTRK KSEEYSVTNT DETVVPPDVP SYLSSQGTLS 
       860        870        880        890        900
DRQETVVRTE GGPQANGHIE SNGVCPRDAS HFPEPDTHSV ACRQPKLCAG 
       910        920        930        940        950
SAYHKEPWKA MEKAEGTPGP HKMEHGGRVV CSDCNTEVDC YSRGQAFHPQ 
       960        970        980        990       1000
PVSRDSAQPS APNGPEPGGS DQEHSPHHQC SRTAAGSCPE CQGSLYPSNH 
      1010       1020       1030       1040       1050
DRMLTAVKKK PMASLDGKGD SSWTLARLYH PDSTELQPAS SLTSGSPERA 
      1060       1070       1080       1090 
EAQYLLVSNG HLPKACDASP ESTPLTGQLP GKQRVPLLLA PKS
Length:1,093
Mass (Da):119,113
Last modified:April 3, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B4F13CA343AF943
GO
Isoform 2 (identifier: Q96JA1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-387: L → LLLLEPSQSAGCSSPSQPHMSAGGR
     644-691: RERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLE → Q

Show »
Length:1,070
Mass (Da):116,378
Checksum:i3EDFDDF0C1319D67
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti24 – 26LLL → VLV in AAK62357 (PubMed:11414704).Curated3
Sequence conflicti24 – 26LLL → VLV in AAH71561 (PubMed:15489334).Curated3
Sequence conflicti80L → F in AAH71561 (PubMed:15489334).Curated1
Sequence conflicti612 – 613TT → VR in CAB56036 (PubMed:17974005).Curated2
Sequence conflicti861G → GA in BAB40659 (Ref. 2) Curated1
Sequence conflicti911M → I in BAB40659 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04988924L → V. Corresponds to variant dbSNP:rs1403626EnsemblClinVar.1
Natural variantiVAR_031581615M → V2 PublicationsCorresponds to variant dbSNP:rs2306272EnsemblClinVar.1
Natural variantiVAR_031582926G → S. Corresponds to variant dbSNP:rs9877201Ensembl.1
Natural variantiVAR_031583957A → T. Corresponds to variant dbSNP:rs332373Ensembl.1
Natural variantiVAR_049890993G → A. Corresponds to variant dbSNP:rs2279289Ensembl.1
Natural variantiVAR_0315841031P → R. Corresponds to variant dbSNP:rs332374Ensembl.1
Natural variantiVAR_0315851053Q → P. Corresponds to variant dbSNP:rs2279290EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011730387L → LLLLEPSQSAGCSSPSQPHM SAGGR in isoform 2. 1 Publication1
Alternative sequenceiVSP_011731644 – 691RERRM…LTVLE → Q in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF381545 mRNA Translation: AAK62357.1
AB050468 mRNA Translation: BAB40659.1
BC071561 mRNA Translation: AAH71561.1
BC014276 mRNA Translation: AAH14276.2
AL117666 mRNA Translation: CAB56036.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33783.1 [Q96JA1-1]

Protein sequence database of the Protein Information Resource

More...PIRi		T17346

NCBI Reference Sequences

More...RefSeqi		NP_056356.2, NM_015541.2 [Q96JA1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000273261; ENSP00000273261; ENSG00000144749 [Q96JA1-1]
ENST00000383703; ENSP00000373208; ENSG00000144749 [Q96JA1-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		26018

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:26018

UCSC genome browser

More...UCSCi		uc003dmx.4, human [Q96JA1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF381545 mRNA Translation: AAK62357.1
AB050468 mRNA Translation: BAB40659.1
BC071561 mRNA Translation: AAH71561.1
BC014276 mRNA Translation: AAH14276.2
AL117666 mRNA Translation: CAB56036.1
CCDSiCCDS33783.1 [Q96JA1-1]
PIRiT17346
RefSeqiNP_056356.2, NM_015541.2 [Q96JA1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4U7LX-ray2.30A42-494[»]
4U7MX-ray2.76A494-781[»]
SMRiQ96JA1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi117489, 42 interactors
IntActiQ96JA1, 32 interactors
STRINGi9606.ENSP00000273261

Protein family/group databases

TCDBi8.A.43.1.21, the neat-domain containing methaemoglobin heme sequestration (n-mhs) family

PTM databases

GlyGeniQ96JA1, 9 sites
iPTMnetiQ96JA1
PhosphoSitePlusiQ96JA1

Polymorphism and mutation databases

BioMutaiLRIG1
DMDMi143811415

Proteomic databases

CPTACiCPTAC-1495
EPDiQ96JA1
jPOSTiQ96JA1
MassIVEiQ96JA1
MaxQBiQ96JA1
PaxDbiQ96JA1
PeptideAtlasiQ96JA1
PRIDEiQ96JA1
ProteomicsDBi76916 [Q96JA1-1]
76917 [Q96JA1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		55087, 221 antibodies

Genome annotation databases

EnsembliENST00000273261; ENSP00000273261; ENSG00000144749 [Q96JA1-1]
ENST00000383703; ENSP00000373208; ENSG00000144749 [Q96JA1-2]
GeneIDi26018
KEGGihsa:26018
UCSCiuc003dmx.4, human [Q96JA1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		26018
DisGeNETi26018
EuPathDBiHostDB:ENSG00000144749.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		LRIG1
HGNCiHGNC:17360, LRIG1
HPAiENSG00000144749, Tissue enhanced (pancreas)
MIMi608868, gene
neXtProtiNX_Q96JA1
OpenTargetsiENSG00000144749
PharmGKBiPA38450

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4194, Eukaryota
GeneTreeiENSGT00940000158502
HOGENOMiCLU_000288_18_24_1
InParanoidiQ96JA1
OMAiWIIEDQS
OrthoDBi161719at2759
PhylomeDBiQ96JA1
TreeFamiTF325380

Enzyme and pathway databases

PathwayCommonsiQ96JA1
ReactomeiR-HSA-177929, Signaling by EGFR
R-HSA-6807004, Negative regulation of MET activity
SignaLinkiQ96JA1
SIGNORiQ96JA1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		26018, 9 hits in 841 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		LRIG1, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		LRIG1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		26018
PharosiQ96JA1, Tbio

Protein Ontology

More...PROi		PR:Q96JA1
RNActiQ96JA1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000144749, Expressed in pancreas and 243 other tissues
GenevisibleiQ96JA1, HS

Family and domain databases

Gene3Di2.60.40.10, 3 hits
3.80.10.10, 2 hits
InterProiView protein in InterPro
IPR000483, Cys-rich_flank_reg_C
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR013098, Ig_I-set
IPR003599, Ig_sub
IPR003598, Ig_sub2
IPR001611, Leu-rich_rpt
IPR003591, Leu-rich_rpt_typical-subtyp
IPR032675, LRR_dom_sf
IPR000372, LRRNT
PfamiView protein in Pfam
PF07679, I-set, 2 hits
PF13855, LRR_8, 5 hits
PF01463, LRRCT, 1 hit
SMARTiView protein in SMART
SM00409, IG, 3 hits
SM00408, IGc2, 3 hits
SM00369, LRR_TYP, 14 hits
SM00082, LRRCT, 1 hit
SM00013, LRRNT, 1 hit
SUPFAMiSSF48726, SSF48726, 3 hits
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 3 hits
PS51450, LRR, 14 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLRIG1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96JA1
Secondary accession number(s): Q6IQ51
, Q96CF9, Q9BYB8, Q9UFI4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: April 3, 2007
Last modified: December 2, 2020
This is version 158 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again