Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96IZ2 (ADTRP_HUMAN)

Entry version 131 (10 Feb 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Androgen-dependent TFPI-regulating protein

Gene

ADTRP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids (PubMed:27018888). Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids (PubMed:27018888). Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro) (PubMed:21868574).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by N-hydroxyhydantoin carbamate JJH260 and beta-lactone KC01.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei47Important for catalytic activity1 Publication1
Sitei131Important for catalytic activity1 Publication1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • hydrolase activity Source: UniProtKB
Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processLipid metabolism

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96IZ2

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...SwissLipidsi		SLP:000001683

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Androgen-dependent TFPI-regulating protein
Alternative name(s):
Fatty acid esters of hydroxy fatty acids hydrolase ADTRP1 Publication (EC:3.1.-.-1 Publication)
Short name:
FAHFA hydrolase ADTRP1 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADTRP
Synonyms:C6orf105
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:21214, ADTRP

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614348, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96IZ2

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000111863.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 3Cytoplasmic1 Publication3
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Topological domaini25 – 46Extracellular1 PublicationAdd BLAST22
Transmembranei47 – 67HelicalSequence analysisAdd BLAST21
Topological domaini68 – 85Cytoplasmic1 PublicationAdd BLAST18
Transmembranei86 – 106HelicalSequence analysisAdd BLAST21
Topological domaini107 – 119Extracellular1 PublicationAdd BLAST13
Transmembranei120 – 140HelicalSequence analysisAdd BLAST21
Topological domaini141 – 154Cytoplasmic1 PublicationAdd BLAST14
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 189Extracellular1 PublicationAdd BLAST14
Transmembranei190 – 210HelicalSequence analysisAdd BLAST21
Topological domaini211 – 230Cytoplasmic1 PublicationAdd BLAST20

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi47T → A: Loss of hydrolase activity. 1 Publication1
Mutagenesisi131H → A: Loss of hydrolase activity. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		84830

Open Targets

More...OpenTargetsi		ENSG00000111863

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134981312

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96IZ2, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADTRP

Domain mapping of disease mutations (DMDM)

More...DMDMi		83286865

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001901001 – 230Androgen-dependent TFPI-regulating proteinAdd BLAST230

Proteomic databases

PeptideAtlas

More...PeptideAtlasi		Q96IZ2

PRoteomics IDEntifications database

More...PRIDEi		Q96IZ2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		76871 [Q96IZ2-1]
76872 [Q96IZ2-2]
76873 [Q96IZ2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96IZ2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96IZ2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in cultured endothelial cells and in placenta.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By androgens.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000111863, Expressed in pigmented layer of retina and 173 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96IZ2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96IZ2, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000111863, Tissue enhanced (ductus deferens, intestine, retina, seminal vesicle)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124285, 5 interactors

Protein interaction database and analysis system

More...IntActi		Q96IZ2, 5 interactors

Molecular INTeraction database

More...MINTi		Q96IZ2

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000229583

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q96IZ2

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96IZ2, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AIG1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3989, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158284

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_073346_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96IZ2

Identification of Orthologs from Complete Genome Data

More...OMAi		FFPPWIN

Database of Orthologous Groups

More...OrthoDBi		1482757at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96IZ2

TreeFam database of animal gene trees

More...TreeFami		TF318170

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006838, Far-17a_AIG1

The PANTHER Classification System

More...PANTHERi		PTHR10989, PTHR10989, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04750, Far-17a_AIG1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96IZ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTKTSTCIYH FLVLSWYTFL NYYISQEGKD EVKPKILANG ARWKYMTLLN 
        60         70         80         90        100
LLLQTIFYGV TCLDDVLKRT KGGKDIKFLT AFRDLLFTTL AFPVSTFVFL 
       110        120        130        140        150
AFWILFLYNR DLIYPKVLDT VIPVWLNHAM HTFIFPITLA EVVLRPHSYP 
       160        170        180        190        200
SKKTGLTLLA AASIAYISRI LWLYFETGTW VYPVFAKLSL LGLAAFFSLS 
       210        220        230
YVFIASIYLL GEKLNHWKWG DMRQPRKKRK
Length:230
Mass (Da):26,842
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i49B964B41C381360
GO
Isoform 2 (identifier: Q96IZ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-52: L → LKNRTAGFDIYQPGSFRQL

Show »
Length:248
Mass (Da):28,922
Checksum:i88183242A57FD4AF
GO
Isoform 3 (identifier: Q96IZ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR

Show »
Length:255
Mass (Da):29,789
Checksum:i934C3EDDD32B17FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YAA5H0YAA5_HUMAN
Androgen-dependent TFPI-regulating ...
ADTRP
116Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9P4H0Y9P4_HUMAN
Androgen-dependent TFPI-regulating ...
ADTRP
120Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9A9D6R9A9_HUMAN
Androgen-dependent TFPI-regulating ...
ADTRP
168Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RDG9D6RDG9_HUMAN
Androgen-dependent TFPI-regulating ...
ADTRP
86Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024365202V → I. Corresponds to variant dbSNP:rs2076185Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04196552L → LKNRTAGFDIYQPGSFRQL in isoform 2. 1 Publication1
Alternative sequenceiVSP_042868220 – 230GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3. CuratedAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK313114 mRNA Translation: BAG35936.1
AK300919 mRNA Translation: BAG62551.1
AL022724 Genomic DNA No translation available.
CH471087 Genomic DNA Translation: EAW55304.1
CH471087 Genomic DNA Translation: EAW55306.1
BC007011 mRNA Translation: AAH07011.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4521.1 [Q96IZ2-1]
CCDS47374.1 [Q96IZ2-2]

NCBI Reference Sequences

More...RefSeqi		NP_001137420.1, NM_001143948.1 [Q96IZ2-2]
NP_116133.1, NM_032744.3 [Q96IZ2-1]
XP_005249511.1, XM_005249454.3 [Q96IZ2-1]
XP_011513258.1, XM_011514956.1 [Q96IZ2-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000229583; ENSP00000229583; ENSG00000111863 [Q96IZ2-2]
ENST00000414691; ENSP00000404416; ENSG00000111863 [Q96IZ2-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84830

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84830

UCSC genome browser

More...UCSCi		uc003nab.4, human [Q96IZ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK313114 mRNA Translation: BAG35936.1
AK300919 mRNA Translation: BAG62551.1
AL022724 Genomic DNA No translation available.
CH471087 Genomic DNA Translation: EAW55304.1
CH471087 Genomic DNA Translation: EAW55306.1
BC007011 mRNA Translation: AAH07011.1
CCDSiCCDS4521.1 [Q96IZ2-1]
CCDS47374.1 [Q96IZ2-2]
RefSeqiNP_001137420.1, NM_001143948.1 [Q96IZ2-2]
NP_116133.1, NM_032744.3 [Q96IZ2-1]
XP_005249511.1, XM_005249454.3 [Q96IZ2-1]
XP_011513258.1, XM_011514956.1 [Q96IZ2-3]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi124285, 5 interactors
IntActiQ96IZ2, 5 interactors
MINTiQ96IZ2
STRINGi9606.ENSP00000229583

Chemistry databases

BindingDBiQ96IZ2
SwissLipidsiSLP:000001683

PTM databases

iPTMnetiQ96IZ2
PhosphoSitePlusiQ96IZ2

Genetic variation databases

BioMutaiADTRP
DMDMi83286865

Proteomic databases

PeptideAtlasiQ96IZ2
PRIDEiQ96IZ2
ProteomicsDBi76871 [Q96IZ2-1]
76872 [Q96IZ2-2]
76873 [Q96IZ2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		63585, 4 antibodies

Genome annotation databases

EnsembliENST00000229583; ENSP00000229583; ENSG00000111863 [Q96IZ2-2]
ENST00000414691; ENSP00000404416; ENSG00000111863 [Q96IZ2-1]
GeneIDi84830
KEGGihsa:84830
UCSCiuc003nab.4, human [Q96IZ2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84830
DisGeNETi84830

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADTRP
HGNCiHGNC:21214, ADTRP
HPAiENSG00000111863, Tissue enhanced (ductus deferens, intestine, retina, seminal vesicle)
MIMi614348, gene
neXtProtiNX_Q96IZ2
OpenTargetsiENSG00000111863
PharmGKBiPA134981312
VEuPathDBiHostDB:ENSG00000111863.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3989, Eukaryota
GeneTreeiENSGT00940000158284
HOGENOMiCLU_073346_2_0_1
InParanoidiQ96IZ2
OMAiFFPPWIN
OrthoDBi1482757at2759
PhylomeDBiQ96IZ2
TreeFamiTF318170

Enzyme and pathway databases

PathwayCommonsiQ96IZ2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84830, 4 hits in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADTRP, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84830
PharosiQ96IZ2, Tbio

Protein Ontology

More...PROi		PR:Q96IZ2
RNActiQ96IZ2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000111863, Expressed in pigmented layer of retina and 173 other tissues
ExpressionAtlasiQ96IZ2, baseline and differential
GenevisibleiQ96IZ2, HS

Family and domain databases

InterProiView protein in InterPro
IPR006838, Far-17a_AIG1
PANTHERiPTHR10989, PTHR10989, 1 hit
PfamiView protein in Pfam
PF04750, Far-17a_AIG1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADTRP_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96IZ2
Secondary accession number(s): B2R7T9, B4DV39, Q5THW1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: December 1, 2001
Last modified: February 10, 2021
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  5. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again