Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein ABHD14B

Gene

ABHD14B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei111Charge relay systemBy similarity1
Active sitei162Charge relay systemBy similarity1
Active sitei188Charge relay systemBy similarity1

GO - Molecular functioni

  • hydrolase activity Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionHydrolase

Enzyme and pathway databases

ReactomeiR-HSA-156584 Cytosolic sulfonation of small molecules

Protein family/group databases

ESTHERihuman-CIB CIB-CCG1-interacting-factor-B
MEROPSiS33.983

Names & Taxonomyi

Protein namesi
Recommended name:
Protein ABHD14BCurated (EC:3.-.-.-)
Alternative name(s):
Alpha/beta hydrolase domain-containing protein 14BCurated
Short name:
Abhydrolase domain-containing protein 14BImported
CCG1-interacting factor B
Gene namesi
Name:ABHD14BImported
Synonyms:CIB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000114779.19
HGNCiHGNC:28235 ABHD14B
neXtProtiNX_Q96IU4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84836
OpenTargetsiENSG00000114779
PharmGKBiPA142672660

Polymorphism and mutation databases

BioMutaiABHD14B
DMDMi34222621

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000650382 – 210Protein ABHD14BAdd BLAST209

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei91PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96IU4
PaxDbiQ96IU4
PeptideAtlasiQ96IU4
PRIDEiQ96IU4
ProteomicsDBi76854
76855 [Q96IU4-2]
TopDownProteomicsiQ96IU4-1 [Q96IU4-1]

2D gel databases

OGPiQ96IU4
REPRODUCTION-2DPAGEiIPI00063827
SWISS-2DPAGEiQ96IU4

PTM databases

iPTMnetiQ96IU4
PhosphoSitePlusiQ96IU4

Expressioni

Tissue specificityi

Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.1 Publication

Gene expression databases

BgeeiENSG00000114779
CleanExiHS_ABHD14B
ExpressionAtlasiQ96IU4 baseline and differential
GenevisibleiQ96IU4 HS

Organism-specific databases

HPAiHPA036444
HPA036642

Interactioni

Subunit structurei

May interact with TAF1.

Protein-protein interaction databases

BioGridi124289, 6 interactors
IntActiQ96IU4, 1 interactor
STRINGi9606.ENSP00000354841

Structurei

Secondary structure

1210
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi5 – 7Combined sources3
Beta strandi12 – 14Combined sources3
Beta strandi17 – 19Combined sources3
Beta strandi21 – 25Combined sources5
Beta strandi27 – 29Combined sources3
Beta strandi34 – 37Combined sources4
Helixi45 – 51Combined sources7
Helixi53 – 59Combined sources7
Beta strandi63 – 67Combined sources5
Helixi73 – 75Combined sources3
Helixi91 – 100Combined sources10
Beta strandi106 – 110Combined sources5
Helixi111 – 113Combined sources3
Helixi114 – 121Combined sources8
Beta strandi129 – 135Combined sources7
Helixi139 – 141Combined sources3
Helixi144 – 148Combined sources5
Beta strandi154 – 159Combined sources6
Helixi163 – 172Combined sources10
Beta strandi175 – 183Combined sources9
Helixi190 – 193Combined sources4
Helixi195 – 207Combined sources13

3D structure databases

ProteinModelPortaliQ96IU4
SMRiQ96IU4
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96IU4

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily. ABHD14 family.Curated

Phylogenomic databases

eggNOGiENOG410IHBA Eukaryota
COG0596 LUCA
GeneTreeiENSGT00510000046860
HOGENOMiHOG000028065
HOVERGENiHBG001936
InParanoidiQ96IU4
KOiK13706
OMAiVMKGAGH
OrthoDBiEOG091G0VZR
PhylomeDBiQ96IU4
TreeFamiTF314465

Family and domain databases

Gene3Di3.40.50.1820, 1 hit
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR000073 AB_hydrolase_1
PfamiView protein in Pfam
PF12697 Abhydrolase_6, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96IU4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAASVEQREG TIQVQGQALF FREALPGSGQ ARFSVLLLHG IRFSSETWQN
60 70 80 90 100
LGTLHRLAQA GYRAVAIDLP GLGHSKEAAA PAPIGELAPG SFLAAVVDAL
110 120 130 140 150
ELGPPVVISP SLSGMYSLPF LTAPGSQLPG FVPVAPICTD KINAANYASV
160 170 180 190 200
KTPALIVYGD QDPMGQTSFE HLKQLPNHRV LIMKGAGHPC YLDKPEEWHT
210
GLLDFLQGLQ
Length:210
Mass (Da):22,346
Last modified:December 1, 2001 - v1
Checksum:i3CACE8759A2ADFAD
GO
Isoform 2 (identifier: Q96IU4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MAASVEQREG...AGYRAVAIDL → MGPGLFPAFLLRPQVTASTRLLPVCASPRSS

Note: No experimental confirmation available.
Show »
Length:172
Mass (Da):18,046
Checksum:i4C73568207B54B5C
GO

Sequence cautioni

The sequence AAH50650 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0080581 – 69MAASV…VAIDL → MGPGLFPAFLLRPQVTASTR LLPVCASPRSS in isoform 2. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK075034 mRNA Translation: BAC11366.1
AK075112 mRNA Translation: BAC11408.1
AK096073 mRNA Translation: BAC04696.1
BC007234 mRNA Translation: AAH07234.1
BC050650 mRNA Translation: AAH50650.1 Different initiation.
BC056411 mRNA Translation: AAH56411.1
CCDSiCCDS2842.1 [Q96IU4-1]
RefSeqiNP_001139786.1, NM_001146314.1 [Q96IU4-1]
NP_001241682.1, NM_001254753.1 [Q96IU4-2]
NP_116139.1, NM_032750.2 [Q96IU4-1]
UniGeneiHs.420796

Genome annotation databases

EnsembliENST00000361143; ENSP00000354841; ENSG00000114779 [Q96IU4-1]
ENST00000395008; ENSP00000378455; ENSG00000114779 [Q96IU4-1]
ENST00000483233; ENSP00000420065; ENSG00000114779 [Q96IU4-1]
ENST00000525795; ENSP00000433388; ENSG00000114779 [Q96IU4-1]
GeneIDi84836
KEGGihsa:84836

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiABHEB_HUMAN
AccessioniPrimary (citable) accession number: Q96IU4
Secondary accession number(s): Q86VK8, Q8N8W5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 22, 2003
Last sequence update: December 1, 2001
Last modified: June 20, 2018
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health