Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96IT1 (ZN496_HUMAN)

Entry version 161 (10 Feb 2021)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein 496

Gene

ZNF496

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

DNA-binding transcription factor that can both act as an activator and a repressor.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri406 – 428C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri435 – 457C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri463 – 485C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri522 – 545C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri553 – 575C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96IT1

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-212436, Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 496
Alternative name(s):
Zinc finger protein with KRAB and SCAN domains 17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF496
Synonyms:ZKSCAN17
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:23713, ZNF496

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		613911, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96IT1

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000162714.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		84838

Open Targets

More...OpenTargetsi		ENSG00000162714

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134888470

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96IT1, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZNF496

Domain mapping of disease mutations (DMDM)

More...DMDMi		55976755

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000476171 – 587Zinc finger protein 496Add BLAST587

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki13Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei185PhosphoserineCombined sources1
Modified residuei299PhosphoserineCombined sources1
Cross-linki403Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki496Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96IT1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96IT1

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96IT1

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96IT1

PeptideAtlas

More...PeptideAtlasi		Q96IT1

PRoteomics IDEntifications database

More...PRIDEi		Q96IT1

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		76850 [Q96IT1-1]
76851 [Q96IT1-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96IT1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96IT1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000162714, Expressed in stomach and 203 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96IT1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96IT1, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000162714, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via zinc-fingers) with JARID2.

Interacts with NSD1 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124291, 43 interactors

Protein interaction database and analysis system

More...IntActi		Q96IT1, 29 interactors

Molecular INTeraction database

More...MINTi		Q96IT1

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000294753

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96IT1, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini42 – 124SCAN boxPROSITE-ProRule annotationAdd BLAST83
Domaini221 – 291KRABPROSITE-ProRule annotationAdd BLAST71

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C2H2-type zinc finger 1, also named C2HR, mediates the interaction with NSD1.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri406 – 428C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri435 – 457C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri463 – 485C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri522 – 545C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri553 – 575C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161967

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002678_49_8_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96IT1

Identification of Orthologs from Complete Genome Data

More...OMAi		DMIFCFS

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96IT1

TreeFam database of animal gene trees

More...TreeFami		TF350829

Family and domain databases

Conserved Domains Database

More...CDDi		cd07765, KRAB_A-box, 1 hit
cd07936, SCAN, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.4020.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001909, KRAB
IPR036051, KRAB_dom_sf
IPR003309, SCAN_dom
IPR038269, SCAN_sf
IPR027767, Zfp496
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

The PANTHER Classification System

More...PANTHERi		PTHR23226:SF180, PTHR23226:SF180, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01352, KRAB, 1 hit
PF02023, SCAN, 1 hit
PF00096, zf-C2H2, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00431, SCAN, 1 hit
SM00355, ZnF_C2H2, 5 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF109640, SSF109640, 1 hit
SSF57667, SSF57667, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50805, KRAB, 1 hit
PS50804, SCAN_BOX, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 4 hits
PS50157, ZINC_FINGER_C2H2_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96IT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPTALCPRVL APKESEEPRK MRSPPGENPS PQGELPSPES SRRLFRRFRY 
        60         70         80         90        100
QEAAGPREAL QRLWDLCGGW LRPERHTKEQ ILELLVLEQF LAILPREIQS 
       110        120        130        140        150
WVRAQEPESG EQAVAAVEAL EREPGRPWQW LKHCEDPVVI DDGDSPLDQE 
       160        170        180        190        200
QEQLPVEPHS DLAKNQDAQP ITLAQCLGLP SRPPSQLSGD PVLQDAFLLQ 
       210        220        230        240        250
EENVRDTQQV TTLQLPPSRV SPFKDMILCF SEEDWSLLDP AQTGFYGEFI 
       260        270        280        290        300
IGEDYGVSMP PNDLAAQPDL SQGEENEPRV PELQDLQGKE VPQVSYLDSP 
       310        320        330        340        350
SLQPFQVEER RKREELQVPE FQACPQTVVP QNTYPAGGNP RSLENSLDEE 
       360        370        380        390        400
VTIEIVLSSS GDEDSQHGPY CTEELGSPTE KQRSLPASHR SSTEAGGEVQ 
       410        420        430        440        450
TSKKSYVCPN CGKIFRWRVN FIRHLRSRRE QEKPHECSVC GELFSDSEDL 
       460        470        480        490        500
DGHLESHEAQ KPYRCGACGK SFRLNSHLLS HRRIHLQPDR LQPVEKREQA 
       510        520        530        540        550
ASEDADKGPK EPLENGKAKL SFQCCECGKA FQRHDHLARH RSHFHLKDKA 
       560        570        580 
RPFQCRYCVK SFTQNYDLLR HERLHMKRRS KQALNSY
Length:587
Mass (Da):66,908
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i72A4F4D5CD309013
GO
Isoform 2 (identifier: Q96IT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-217: P → PRIFQFNNHRSNGYILEMLGSGGKKAQIISVLSQIYV

Show »
Length:623
Mass (Da):70,973
Checksum:iDF5166381C72A355
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DGR5A0A0C4DGR5_HUMAN
Zinc finger protein 496
ZNF496
512Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_038755217P → PRIFQFNNHRSNGYILEMLG SGGKKAQIISVLSQIYV in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AC104335 Genomic DNA No translation available.
BC007263 mRNA Translation: AAH07263.1
BC025794 mRNA Translation: AAH25794.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1631.1 [Q96IT1-1]

NCBI Reference Sequences

More...RefSeqi		NP_116141.1, NM_032752.2 [Q96IT1-1]
XP_005273385.1, XM_005273328.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000294753; ENSP00000294753; ENSG00000162714 [Q96IT1-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84838

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84838

UCSC genome browser

More...UCSCi		uc001ico.4, human [Q96IT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC104335 Genomic DNA No translation available.
BC007263 mRNA Translation: AAH07263.1
BC025794 mRNA Translation: AAH25794.1
CCDSiCCDS1631.1 [Q96IT1-1]
RefSeqiNP_116141.1, NM_032752.2 [Q96IT1-1]
XP_005273385.1, XM_005273328.3

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi124291, 43 interactors
IntActiQ96IT1, 29 interactors
MINTiQ96IT1
STRINGi9606.ENSP00000294753

PTM databases

iPTMnetiQ96IT1
PhosphoSitePlusiQ96IT1

Genetic variation databases

BioMutaiZNF496
DMDMi55976755

Proteomic databases

jPOSTiQ96IT1
MassIVEiQ96IT1
MaxQBiQ96IT1
PaxDbiQ96IT1
PeptideAtlasiQ96IT1
PRIDEiQ96IT1
ProteomicsDBi76850 [Q96IT1-1]
76851 [Q96IT1-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		20839, 156 antibodies

The DNASU plasmid repository

More...DNASUi		84838

Genome annotation databases

EnsembliENST00000294753; ENSP00000294753; ENSG00000162714 [Q96IT1-1]
GeneIDi84838
KEGGihsa:84838
UCSCiuc001ico.4, human [Q96IT1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84838
DisGeNETi84838

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZNF496
HGNCiHGNC:23713, ZNF496
HPAiENSG00000162714, Low tissue specificity
MIMi613911, gene
neXtProtiNX_Q96IT1
OpenTargetsiENSG00000162714
PharmGKBiPA134888470
VEuPathDBiHostDB:ENSG00000162714.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000161967
HOGENOMiCLU_002678_49_8_1
InParanoidiQ96IT1
OMAiDMIFCFS
OrthoDBi1318335at2759
PhylomeDBiQ96IT1
TreeFamiTF350829

Enzyme and pathway databases

PathwayCommonsiQ96IT1
ReactomeiR-HSA-212436, Generic Transcription Pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84838, 3 hits in 896 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ZNF496, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84838
PharosiQ96IT1, Tdark

Protein Ontology

More...PROi		PR:Q96IT1
RNActiQ96IT1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000162714, Expressed in stomach and 203 other tissues
ExpressionAtlasiQ96IT1, baseline and differential
GenevisibleiQ96IT1, HS

Family and domain databases

CDDicd07765, KRAB_A-box, 1 hit
cd07936, SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR001909, KRAB
IPR036051, KRAB_dom_sf
IPR003309, SCAN_dom
IPR038269, SCAN_sf
IPR027767, Zfp496
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PANTHERiPTHR23226:SF180, PTHR23226:SF180, 1 hit
PfamiView protein in Pfam
PF01352, KRAB, 1 hit
PF02023, SCAN, 1 hit
PF00096, zf-C2H2, 2 hits
SMARTiView protein in SMART
SM00431, SCAN, 1 hit
SM00355, ZnF_C2H2, 5 hits
SUPFAMiSSF109640, SSF109640, 1 hit
SSF57667, SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50805, KRAB, 1 hit
PS50804, SCAN_BOX, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 4 hits
PS50157, ZINC_FINGER_C2H2_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN496_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96IT1
Secondary accession number(s): Q8TBS2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: December 1, 2001
Last modified: February 10, 2021
This is version 161 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again