Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q96I24 (FUBP3_HUMAN)

Entry version 184 (29 Sep 2021)
Sequence version 2 (26 Sep 2003)
Previous versions | rss
Add a publicationFeedback
Protein

Far upstream element-binding protein 3

Gene

FUBP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96I24

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Far upstream element-binding protein 3
Short name:
FUSE-binding protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FUBP3
Synonyms:FBP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:4005, FUBP3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		603536, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96I24

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000107164

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		8939

Open Targets

More...OpenTargetsi		ENSG00000107164

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA28421

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96I24, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		FUBP3

Domain mapping of disease mutations (DMDM)

More...DMDMi		37078499

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000501402 – 572Far upstream element-binding protein 3Add BLAST571

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki15Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki57Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei76PhosphothreonineCombined sources1
Modified residuei296PhosphoserineCombined sources1
Modified residuei539PhosphoserineCombined sources1
Modified residuei569PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96I24

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96I24

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96I24

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96I24

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96I24

PeptideAtlas

More...PeptideAtlasi		Q96I24

PRoteomics IDEntifications database

More...PRIDEi		Q96I24

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		76805 [Q96I24-1]
76806 [Q96I24-2]

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00377261

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q96I24, 4 sites, 1 O-linked glycan (4 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96I24

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q96I24

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96I24

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q96I24

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in a number of cell lines.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000107164, Expressed in brain and 240 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96I24, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96I24, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000107164, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		114451, 229 interactors

Database of interacting proteins

More...DIPi		DIP-50124N

Protein interaction database and analysis system

More...IntActi		Q96I24, 55 interactors

Molecular INTeraction database

More...MINTi		Q96I24

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000318177

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96I24, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96I24

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini77 – 141KH 1PROSITE-ProRule annotationAdd BLAST65
Domaini162 – 228KH 2PROSITE-ProRule annotationAdd BLAST67
Domaini253 – 317KH 3PROSITE-ProRule annotationAdd BLAST65
Domaini354 – 421KH 4PROSITE-ProRule annotationAdd BLAST68

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni426 – 521DisorderedSequence analysisAdd BLAST96

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi468 – 518Polar residuesSequence analysisAdd BLAST51

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1676, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156744

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_014285_1_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96I24

Identification of Orthologs from Complete Genome Data

More...OMAi		HQNGQTF

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96I24

TreeFam database of animal gene trees

More...TreeFami		TF313654

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.1370.10, 4 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR004087, KH_dom
IPR004088, KH_dom_type_1
IPR036612, KH_dom_type_1_sf

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00013, KH_1, 4 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00322, KH, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54791, SSF54791, 4 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50084, KH_TYPE_1, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96I24-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAELVQGQSA PVGMKAEGFV DALHRVRQIA AKIDSIPHLN NSTPLVDPSV 
        60         70         80         90        100
YGYGVQKRPL DDGVGNQLGA LVHQRTVITE EFKVPDKMVG FIIGRGGEQI 
       110        120        130        140        150
SRIQAESGCK IQIASESSGI PERPCVLTGT PESIEQAKRL LGQIVDRCRN 
       160        170        180        190        200
GPGFHNDIDS NSTIQEILIP ASKVGLVIGR GGETIKQLQE RTGVKMVMIQ 
       210        220        230        240        250
DGPLPTGADK PLRITGDAFK VQQAREMVLE IIREKDQADF RGVRGDFNSR 
       260        270        280        290        300
MGGGSIEVSV PRFAVGIVIG RNGEMIKKIQ NDAGVRIQFK PDDGISPERA 
       310        320        330        340        350
AQVMGPPDRC QHAAHIISEL ILTAQERDGF GGLAAARGRG RGRGDWSVGA 
       360        370        380        390        400
PGGVQEITYT VPADKCGLVI GKGGENIKSI NQQSGAHVEL QRNPPPNSDP 
       410        420        430        440        450
NLRRFTIRGV PQQIEVARQL IDEKVGGTNL GAPGAFGQSP FSQPPAPPHQ 
       460        470        480        490        500
NTFPPRSSGC FPNMAAKVNG NPHSTPVSGP PAFLTQGWGS TYQAWQQPTQ 
       510        520        530        540        550
QVPSQQSQPQ SSQPNYSKAW EDYYKKQSHA ASAAPQASSP PDYTMAWAEY 
       560        570 
YRQQVAFYGQ TLGQAQAHSQ EQ
Length:572
Mass (Da):61,640
Last modified:September 26, 2003 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF1BE223542BC197D
GO
Isoform 2 (identifier: Q96I24-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPLDDGV → MPPI
     298-548: Missing.

Show »
Length:261
Mass (Da):28,492
Checksum:i6D70D9731D957E6D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A494C1K6A0A494C1K6_HUMAN
Far upstream element-binding protei...
FUBP3
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC50893 differs from that shown. Reason: Frameshift.Curated
The sequence AAH01325 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti72V → D in AAC50893 (PubMed:8940189).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0083231 – 64MAELV…LDDGV → MPPI in isoform 2. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_008324298 – 548Missing in isoform 2. 1 PublicationAdd BLAST251

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U69127 mRNA Translation: AAC50893.1 Frameshift.
AK295155 mRNA Translation: BAG58170.1
AL353695 Genomic DNA No translation available.
AL359092 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87937.1
BC001325 mRNA Translation: AAH01325.1 Frameshift.
BC007874 mRNA Translation: AAH07874.1
BC137338 mRNA Translation: AAI37339.1
BC137340 mRNA Translation: AAI37341.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS43893.1 [Q96I24-1]

NCBI Reference Sequences

More...RefSeqi		NP_003925.1, NM_003934.1 [Q96I24-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000319725; ENSP00000318177; ENSG00000107164 [Q96I24-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		8939

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:8939

UCSC genome browser

More...UCSCi		uc004bzr.2, human [Q96I24-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U69127 mRNA Translation: AAC50893.1 Frameshift.
AK295155 mRNA Translation: BAG58170.1
AL353695 Genomic DNA No translation available.
AL359092 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87937.1
BC001325 mRNA Translation: AAH01325.1 Frameshift.
BC007874 mRNA Translation: AAH07874.1
BC137338 mRNA Translation: AAI37339.1
BC137340 mRNA Translation: AAI37341.1
CCDSiCCDS43893.1 [Q96I24-1]
RefSeqiNP_003925.1, NM_003934.1 [Q96I24-1]

3D structure databases

SMRiQ96I24
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi114451, 229 interactors
DIPiDIP-50124N
IntActiQ96I24, 55 interactors
MINTiQ96I24
STRINGi9606.ENSP00000318177

PTM databases

GlyGeniQ96I24, 4 sites, 1 O-linked glycan (4 sites)
iPTMnetiQ96I24
MetOSiteiQ96I24
PhosphoSitePlusiQ96I24
SwissPalmiQ96I24

Genetic variation databases

BioMutaiFUBP3
DMDMi37078499

2D gel databases

REPRODUCTION-2DPAGEiIPI00377261

Proteomic databases

EPDiQ96I24
jPOSTiQ96I24
MassIVEiQ96I24
MaxQBiQ96I24
PaxDbiQ96I24
PeptideAtlasiQ96I24
PRIDEiQ96I24
ProteomicsDBi76805 [Q96I24-1]
76806 [Q96I24-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31511, 295 antibodies

The DNASU plasmid repository

More...DNASUi		8939

Genome annotation databases

EnsembliENST00000319725; ENSP00000318177; ENSG00000107164 [Q96I24-1]
GeneIDi8939
KEGGihsa:8939
UCSCiuc004bzr.2, human [Q96I24-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		8939
DisGeNETi8939

GeneCards: human genes, protein and diseases

More...GeneCardsi		FUBP3
HGNCiHGNC:4005, FUBP3
HPAiENSG00000107164, Low tissue specificity
MIMi603536, gene
neXtProtiNX_Q96I24
OpenTargetsiENSG00000107164
PharmGKBiPA28421
VEuPathDBiHostDB:ENSG00000107164

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1676, Eukaryota
GeneTreeiENSGT00940000156744
HOGENOMiCLU_014285_1_1_1
InParanoidiQ96I24
OMAiHQNGQTF
PhylomeDBiQ96I24
TreeFamiTF313654

Enzyme and pathway databases

PathwayCommonsiQ96I24

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		8939, 10 hits in 1021 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		FUBP3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		8939
PharosiQ96I24, Tbio

Protein Ontology

More...PROi		PR:Q96I24
RNActiQ96I24, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000107164, Expressed in brain and 240 other tissues
ExpressionAtlasiQ96I24, baseline and differential
GenevisibleiQ96I24, HS

Family and domain databases

Gene3Di3.30.1370.10, 4 hits
InterProiView protein in InterPro
IPR004087, KH_dom
IPR004088, KH_dom_type_1
IPR036612, KH_dom_type_1_sf
PfamiView protein in Pfam
PF00013, KH_1, 4 hits
SMARTiView protein in SMART
SM00322, KH, 4 hits
SUPFAMiSSF54791, SSF54791, 4 hits
PROSITEiView protein in PROSITE
PS50084, KH_TYPE_1, 4 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFUBP3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96I24
Secondary accession number(s): A3KFK8
, A3KFL0, Q92946, Q9BVB6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: September 26, 2003
Last modified: September 29, 2021
This is version 184 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again