Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96HQ2 (C2AIL_HUMAN)

Entry version 122 (02 Dec 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

CDKN2AIP N-terminal-like protein

Gene

CDKN2AIPNL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96HQ2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CDKN2AIP N-terminal-like protein
Alternative name(s):
CDKN2A-interacting protein N-terminal-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDKN2AIPNL
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000237190.3

Human Gene Nomenclature Database

More...HGNCi		HGNC:30545, CDKN2AIPNL

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96HQ2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi81Y → A: Abolishes binding to XRN2. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		91368

Open Targets

More...OpenTargetsi		ENSG00000237190

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162382150

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96HQ2, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CDKN2AIPNL

Domain mapping of disease mutations (DMDM)

More...DMDMi		74731962

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003259261 – 116CDKN2AIP N-terminal-like proteinAdd BLAST116

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1 Publication1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96HQ2

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96HQ2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96HQ2

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96HQ2

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96HQ2

PeptideAtlas

More...PeptideAtlasi		Q96HQ2

PRoteomics IDEntifications database

More...PRIDEi		Q96HQ2

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		76776 [Q96HQ2-1]
76777 [Q96HQ2-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		Q96HQ2-1 [Q96HQ2-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96HQ2

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q96HQ2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96HQ2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000237190, Expressed in quadriceps femoris and 196 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96HQ2, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000237190, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with XRN2; the interaction is direct.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124820, 16 interactors

Database of interacting proteins

More...DIPi		DIP-61982N

Protein interaction database and analysis system

More...IntActi		Q96HQ2, 15 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000394183

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96HQ2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96HQ2

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini24 – 116XRN2-binding (XTBD)PROSITE-ProRule annotationAdd BLAST93

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CARF family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S4FT, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157177

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_148771_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96HQ2

Identification of Orthologs from Complete Genome Data

More...OMAi		WESDKHW

Database of Orthologous Groups

More...OrthoDBi		1524198at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96HQ2

TreeFam database of animal gene trees

More...TreeFami		TF333807

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR021859, XTBD

Pfam protein domain database

More...Pfami		View protein in Pfam
PF11952, XTBD, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS51827, XTBD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q96HQ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVGGEAAAAV EELVSGVRQA ADFAEQFRSY SESEKQWKAR MEFILRHLPD 
        60         70         80         90        100
YRDPPDGSGR LDQLLSLSMV WANHLFLGCS YNKDLLDKVM EMADGIEVED 
       110 
LPQFTTRSEL MKKHQS
Length:116
Mass (Da):13,196
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i26166C4274FE679C
GO
Isoform 2 (identifier: Q96HQ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-116: YNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS → PRGPK

Show »
Length:85
Mass (Da):9,509
Checksum:i6CCE2CF58A38A3F7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03248681 – 116YNKDL…KKHQS → PRGPK in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
CH471062 Genomic DNA Translation: EAW62260.1
CH471062 Genomic DNA Translation: EAW62261.1
BC008293 mRNA Translation: AAH08293.1
BC018086 mRNA Translation: AAH18086.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS4175.1 [Q96HQ2-1]

NCBI Reference Sequences

More...RefSeqi		NP_542387.1, NM_080656.2 [Q96HQ2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000395009; ENSP00000378456; ENSG00000237190 [Q96HQ2-2]
ENST00000458198; ENSP00000394183; ENSG00000237190 [Q96HQ2-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		91368

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:91368

UCSC genome browser

More...UCSCi		uc011cxs.3, human [Q96HQ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471062 Genomic DNA Translation: EAW62260.1
CH471062 Genomic DNA Translation: EAW62261.1
BC008293 mRNA Translation: AAH08293.1
BC018086 mRNA Translation: AAH18086.1
CCDSiCCDS4175.1 [Q96HQ2-1]
RefSeqiNP_542387.1, NM_080656.2 [Q96HQ2-1]

3D structure databases

SMRiQ96HQ2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124820, 16 interactors
DIPiDIP-61982N
IntActiQ96HQ2, 15 interactors
STRINGi9606.ENSP00000394183

PTM databases

iPTMnetiQ96HQ2
MetOSiteiQ96HQ2
PhosphoSitePlusiQ96HQ2

Polymorphism and mutation databases

BioMutaiCDKN2AIPNL
DMDMi74731962

Proteomic databases

EPDiQ96HQ2
jPOSTiQ96HQ2
MassIVEiQ96HQ2
MaxQBiQ96HQ2
PaxDbiQ96HQ2
PeptideAtlasiQ96HQ2
PRIDEiQ96HQ2
ProteomicsDBi76776 [Q96HQ2-1]
76777 [Q96HQ2-2]
TopDownProteomicsiQ96HQ2-1 [Q96HQ2-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		64397, 35 antibodies

The DNASU plasmid repository

More...DNASUi		91368

Genome annotation databases

EnsembliENST00000395009; ENSP00000378456; ENSG00000237190 [Q96HQ2-2]
ENST00000458198; ENSP00000394183; ENSG00000237190 [Q96HQ2-1]
GeneIDi91368
KEGGihsa:91368
UCSCiuc011cxs.3, human [Q96HQ2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		91368
DisGeNETi91368
EuPathDBiHostDB:ENSG00000237190.3

GeneCards: human genes, protein and diseases

More...GeneCardsi		CDKN2AIPNL
HGNCiHGNC:30545, CDKN2AIPNL
HPAiENSG00000237190, Low tissue specificity
neXtProtiNX_Q96HQ2
OpenTargetsiENSG00000237190
PharmGKBiPA162382150

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S4FT, Eukaryota
GeneTreeiENSGT00940000157177
HOGENOMiCLU_148771_0_0_1
InParanoidiQ96HQ2
OMAiWESDKHW
OrthoDBi1524198at2759
PhylomeDBiQ96HQ2
TreeFamiTF333807

Enzyme and pathway databases

PathwayCommonsiQ96HQ2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		91368, 20 hits in 840 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CDKN2AIPNL, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		91368
PharosiQ96HQ2, Tdark

Protein Ontology

More...PROi		PR:Q96HQ2
RNActiQ96HQ2, protein

Gene expression databases

BgeeiENSG00000237190, Expressed in quadriceps femoris and 196 other tissues
GenevisibleiQ96HQ2, HS

Family and domain databases

InterProiView protein in InterPro
IPR021859, XTBD
PfamiView protein in Pfam
PF11952, XTBD, 1 hit
PROSITEiView protein in PROSITE
PS51827, XTBD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC2AIL_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96HQ2
Secondary accession number(s): Q8WVE3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: December 1, 2001
Last modified: December 2, 2020
This is version 122 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again