Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GRAM domain-containing protein 2B

Gene

GRAMD2B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • identical protein binding Source: IntAct

Names & Taxonomyi

Protein namesi
Recommended name:
GRAM domain-containing protein 2B
Alternative name(s):
HCV NS3-transactivated protein 2
Gene namesi
Name:GRAMD2B
Synonyms:GRAMD3, NS3TP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000155324.9
HGNCiHGNC:24911 GRAMD2B
neXtProtiNX_Q96HH9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi65983
OpenTargetsiENSG00000155324
PharmGKBiPA142671711

Polymorphism and mutation databases

BioMutaiGRAMD3
DMDMi74731934

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000875771 – 432GRAM domain-containing protein 2BAdd BLAST432

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei225PhosphoserineBy similarity1
Modified residuei242PhosphoserineBy similarity1
Modified residuei252PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96HH9
MaxQBiQ96HH9
PaxDbiQ96HH9
PeptideAtlasiQ96HH9
PRIDEiQ96HH9
ProteomicsDBi76749
76750 [Q96HH9-2]
76751 [Q96HH9-3]
76752 [Q96HH9-4]

PTM databases

iPTMnetiQ96HH9
PhosphoSitePlusiQ96HH9

Expressioni

Gene expression databases

BgeeiENSG00000155324 Expressed in 217 organ(s), highest expression level in temporal lobe
CleanExiHS_GRAMD3
ExpressionAtlasiQ96HH9 baseline and differential
GenevisibleiQ96HH9 HS

Organism-specific databases

HPAiHPA009678
HPA010095

Interactioni

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122433, 27 interactors
IntActiQ96HH9, 14 interactors
MINTiQ96HH9

Structurei

3D structure databases

ProteinModelPortaliQ96HH9
SMRiQ96HH9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini110 – 177GRAMAdd BLAST68

Phylogenomic databases

eggNOGiENOG410IRAJ Eukaryota
ENOG4111H65 LUCA
GeneTreeiENSGT00580000081380
HOGENOMiHOG000082410
HOVERGENiHBG055715
InParanoidiQ96HH9
OMAiKCPTLHH
OrthoDBiEOG091G051I
PhylomeDBiQ96HH9
TreeFamiTF332065

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR004182 GRAM
IPR011993 PH-like_dom_sf
PfamiView protein in Pfam
PF02893 GRAM, 1 hit
SMARTiView protein in SMART
SM00568 GRAM, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96HH9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTELQQDVED TKPAKVLGKR ESKLGSAHSE AENGVEEKKK ACRSPTAQSP
60 70 80 90 100
TPSVEADSPD QKKIISLWSK SSFDGASLAS DKNDCKTESK NDPKTERKKS
110 120 130 140 150
SSSSQYKANM HFHKLFLSVP TEEPLKQSFT CALQKEILYQ GKLFVSENWI
160 170 180 190 200
CFHSKVFGKD TKISIPAFSV TLIKKTKTAL LVPNALIIAT VTDRYIFVSL
210 220 230 240 250
LSRDSTYKLL KSVCGHLENT SVGNSPNPSS AENSFRADRP SSLPLDFNDE
260 270 280 290 300
FSDLDGVVQQ RRQDMEGYSS SGSQTPESEN SRDFHATESQ TVLNVSKGEA
310 320 330 340 350
KPTRADAHVN RVPEGKAKSL PVQGLSETVG ILHKVKSQKC PMLHHILIFY
360 370 380 390 400
AIVVCALIIS TFYMRYRINT LEEQLGLLTS IVDTHNTEQA APSGLRSQVQ
410 420 430
FNVEVLCQEL TANIVKLEKI QNNLQKLLEN GD
Length:432
Mass (Da):47,869
Last modified:December 1, 2001 - v1
Checksum:i65F5CE61C13D19C4
GO
Isoform 2 (identifier: Q96HH9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTELQQDVED...PDQKKIISLW → MWKTQSLRKC...PNLCFIQDQE

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,585
Checksum:i41DE0127B5C3E28F
GO
Isoform 3 (identifier: Q96HH9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MTELQQDVEDTKPAKVLGKRESKLGSAH → MTRRQQVLQAKRSIQQTFQAQLMPWKSMFHGREVKPVGPDLEL

Note: No experimental confirmation available.
Show »
Length:447
Mass (Da):49,869
Checksum:i79F9C0CC55E9612A
GO
Isoform 4 (identifier: Q96HH9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MTELQQDVEDTKPAKVLGKRESKLGSAH → MSKVKRFPFFFS

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):46,294
Checksum:iF44DFAFD659007B0
GO
Isoform 5 (identifier: Q96HH9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     105-105: Q → M

Show »
Length:328
Mass (Da):36,649
Checksum:i9B719A910D8AE809
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z4W8B7Z4W8_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
323Annotation score:
E9PD09E9PD09_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
410Annotation score:
D6REP5D6REP5_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
288Annotation score:
D6R9P9D6R9P9_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
87Annotation score:
D6RFH3D6RFH3_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
87Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti260Q → R in AAM77213 (Ref. 1) Curated1
Sequence conflicti260Q → R in BAB15045 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0442981 – 104Missing in isoform 5. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_0428831 – 68MTELQ…IISLW → MWKTQSLRKCSGRGRANLAQ PTQRLRMVWRRKRKPAGRQQ PNPLPHLWRRTPQTRRKSLA YAHIFSPNLCFIQDQE in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0428841 – 28MTELQ…LGSAH → MTRRQQVLQAKRSIQQTFQA QLMPWKSMFHGREVKPVGPD LEL in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0428851 – 28MTELQ…LGSAH → MSKVKRFPFFFS in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_044299105Q → M in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY116970 mRNA Translation: AAM77213.1
AK024966 mRNA Translation: BAB15045.1
AK293307 mRNA Translation: BAH11488.1
AK296267 mRNA Translation: BAH12297.1
AK300154 mRNA Translation: BAH13224.1
AK303857 mRNA Translation: BAH14068.1
AK316288 mRNA Translation: BAH14659.1
AC008546 Genomic DNA No translation available.
AC093535 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48852.1
CH471086 Genomic DNA Translation: EAW48854.1
CH471086 Genomic DNA Translation: EAW48855.1
BC008590 mRNA Translation: AAH08590.1
CCDSiCCDS4136.1 [Q96HH9-1]
CCDS54891.1 [Q96HH9-3]
CCDS54892.1 [Q96HH9-2]
CCDS54893.1 [Q96HH9-4]
CCDS54894.1 [Q96HH9-5]
RefSeqiNP_001139791.1, NM_001146319.1 [Q96HH9-3]
NP_001139792.1, NM_001146320.1 [Q96HH9-5]
NP_001139793.1, NM_001146321.1 [Q96HH9-2]
NP_001139794.1, NM_001146322.1 [Q96HH9-4]
NP_076416.2, NM_023927.2 [Q96HH9-1]
XP_005272120.1, XM_005272063.3 [Q96HH9-4]
XP_016865274.1, XM_017009785.1 [Q96HH9-5]
UniGeneiHs.363558
Hs.675231

Genome annotation databases

EnsembliENST00000285689; ENSP00000285689; ENSG00000155324 [Q96HH9-1]
ENST00000511134; ENSP00000426088; ENSG00000155324 [Q96HH9-4]
ENST00000513040; ENSP00000426120; ENSG00000155324 [Q96HH9-3]
ENST00000542322; ENSP00000441876; ENSG00000155324 [Q96HH9-2]
ENST00000544396; ENSP00000444049; ENSG00000155324 [Q96HH9-5]
GeneIDi65983
KEGGihsa:65983
UCSCiuc003ktu.4 human [Q96HH9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY116970 mRNA Translation: AAM77213.1
AK024966 mRNA Translation: BAB15045.1
AK293307 mRNA Translation: BAH11488.1
AK296267 mRNA Translation: BAH12297.1
AK300154 mRNA Translation: BAH13224.1
AK303857 mRNA Translation: BAH14068.1
AK316288 mRNA Translation: BAH14659.1
AC008546 Genomic DNA No translation available.
AC093535 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48852.1
CH471086 Genomic DNA Translation: EAW48854.1
CH471086 Genomic DNA Translation: EAW48855.1
BC008590 mRNA Translation: AAH08590.1
CCDSiCCDS4136.1 [Q96HH9-1]
CCDS54891.1 [Q96HH9-3]
CCDS54892.1 [Q96HH9-2]
CCDS54893.1 [Q96HH9-4]
CCDS54894.1 [Q96HH9-5]
RefSeqiNP_001139791.1, NM_001146319.1 [Q96HH9-3]
NP_001139792.1, NM_001146320.1 [Q96HH9-5]
NP_001139793.1, NM_001146321.1 [Q96HH9-2]
NP_001139794.1, NM_001146322.1 [Q96HH9-4]
NP_076416.2, NM_023927.2 [Q96HH9-1]
XP_005272120.1, XM_005272063.3 [Q96HH9-4]
XP_016865274.1, XM_017009785.1 [Q96HH9-5]
UniGeneiHs.363558
Hs.675231

3D structure databases

ProteinModelPortaliQ96HH9
SMRiQ96HH9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122433, 27 interactors
IntActiQ96HH9, 14 interactors
MINTiQ96HH9

PTM databases

iPTMnetiQ96HH9
PhosphoSitePlusiQ96HH9

Polymorphism and mutation databases

BioMutaiGRAMD3
DMDMi74731934

Proteomic databases

EPDiQ96HH9
MaxQBiQ96HH9
PaxDbiQ96HH9
PeptideAtlasiQ96HH9
PRIDEiQ96HH9
ProteomicsDBi76749
76750 [Q96HH9-2]
76751 [Q96HH9-3]
76752 [Q96HH9-4]

Protocols and materials databases

DNASUi65983
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000285689; ENSP00000285689; ENSG00000155324 [Q96HH9-1]
ENST00000511134; ENSP00000426088; ENSG00000155324 [Q96HH9-4]
ENST00000513040; ENSP00000426120; ENSG00000155324 [Q96HH9-3]
ENST00000542322; ENSP00000441876; ENSG00000155324 [Q96HH9-2]
ENST00000544396; ENSP00000444049; ENSG00000155324 [Q96HH9-5]
GeneIDi65983
KEGGihsa:65983
UCSCiuc003ktu.4 human [Q96HH9-1]

Organism-specific databases

CTDi65983
DisGeNETi65983
EuPathDBiHostDB:ENSG00000155324.9
GeneCardsiGRAMD2B
HGNCiHGNC:24911 GRAMD2B
HPAiHPA009678
HPA010095
neXtProtiNX_Q96HH9
OpenTargetsiENSG00000155324
PharmGKBiPA142671711
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IRAJ Eukaryota
ENOG4111H65 LUCA
GeneTreeiENSGT00580000081380
HOGENOMiHOG000082410
HOVERGENiHBG055715
InParanoidiQ96HH9
OMAiKCPTLHH
OrthoDBiEOG091G051I
PhylomeDBiQ96HH9
TreeFamiTF332065

Miscellaneous databases

ChiTaRSiGRAMD3 human
GenomeRNAii65983
PROiPR:Q96HH9

Gene expression databases

BgeeiENSG00000155324 Expressed in 217 organ(s), highest expression level in temporal lobe
CleanExiHS_GRAMD3
ExpressionAtlasiQ96HH9 baseline and differential
GenevisibleiQ96HH9 HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR004182 GRAM
IPR011993 PH-like_dom_sf
PfamiView protein in Pfam
PF02893 GRAM, 1 hit
SMARTiView protein in SMART
SM00568 GRAM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiGRM2B_HUMAN
AccessioniPrimary (citable) accession number: Q96HH9
Secondary accession number(s): B7Z1F2
, B7Z3R1, B7Z6D8, B7Z8T2, D3DSZ3, Q9H753
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 1, 2001
Last modified: November 7, 2018
This is version 126 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again