Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (07 Oct 2020)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

GRAM domain-containing protein 2B

Gene

GRAMD2B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q96HH9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
GRAM domain-containing protein 2B
Alternative name(s):
HCV NS3-transactivated protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GRAMD2B
Synonyms:GRAMD3, NS3TP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000155324.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24911, GRAMD2B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q96HH9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
65983

Open Targets

More...
OpenTargetsi
ENSG00000155324

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671711

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q96HH9, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
GRAMD2B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74731934

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000875771 – 432GRAM domain-containing protein 2BAdd BLAST432

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei225PhosphoserineBy similarity1
Modified residuei242PhosphoserineBy similarity1
Modified residuei252PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q96HH9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q96HH9

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q96HH9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q96HH9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q96HH9

PeptideAtlas

More...
PeptideAtlasi
Q96HH9

PRoteomics IDEntifications database

More...
PRIDEi
Q96HH9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
6327
76749 [Q96HH9-1]
76750 [Q96HH9-2]
76751 [Q96HH9-3]
76752 [Q96HH9-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q96HH9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q96HH9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000155324, Expressed in calcaneal tendon and 228 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q96HH9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q96HH9, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000155324, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
122433, 35 interactors

Protein interaction database and analysis system

More...
IntActi
Q96HH9, 29 interactors

Molecular INTeraction database

More...
MINTi
Q96HH9

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000426120

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q96HH9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q96HH9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini110 – 177GRAMAdd BLAST68

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1032, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156980

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q96HH9

Identification of Orthologs from Complete Genome Data

More...
OMAi
KCPTLHH

Database of Orthologous Groups

More...
OrthoDBi
944155at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q96HH9

TreeFam database of animal gene trees

More...
TreeFami
TF332065

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004182, GRAM
IPR011993, PH-like_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02893, GRAM, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00568, GRAM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96HH9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTELQQDVED TKPAKVLGKR ESKLGSAHSE AENGVEEKKK ACRSPTAQSP
60 70 80 90 100
TPSVEADSPD QKKIISLWSK SSFDGASLAS DKNDCKTESK NDPKTERKKS
110 120 130 140 150
SSSSQYKANM HFHKLFLSVP TEEPLKQSFT CALQKEILYQ GKLFVSENWI
160 170 180 190 200
CFHSKVFGKD TKISIPAFSV TLIKKTKTAL LVPNALIIAT VTDRYIFVSL
210 220 230 240 250
LSRDSTYKLL KSVCGHLENT SVGNSPNPSS AENSFRADRP SSLPLDFNDE
260 270 280 290 300
FSDLDGVVQQ RRQDMEGYSS SGSQTPESEN SRDFHATESQ TVLNVSKGEA
310 320 330 340 350
KPTRADAHVN RVPEGKAKSL PVQGLSETVG ILHKVKSQKC PMLHHILIFY
360 370 380 390 400
AIVVCALIIS TFYMRYRINT LEEQLGLLTS IVDTHNTEQA APSGLRSQVQ
410 420 430
FNVEVLCQEL TANIVKLEKI QNNLQKLLEN GD
Length:432
Mass (Da):47,869
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i65F5CE61C13D19C4
GO
Isoform 2 (identifier: Q96HH9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTELQQDVED...PDQKKIISLW → MWKTQSLRKC...PNLCFIQDQE

Show »
Length:440
Mass (Da):49,585
Checksum:i41DE0127B5C3E28F
GO
Isoform 3 (identifier: Q96HH9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MTELQQDVEDTKPAKVLGKRESKLGSAH → MTRRQQVLQAKRSIQQTFQAQLMPWKSMFHGREVKPVGPDLEL

Show »
Length:447
Mass (Da):49,869
Checksum:i79F9C0CC55E9612A
GO
Isoform 4 (identifier: Q96HH9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MTELQQDVEDTKPAKVLGKRESKLGSAH → MSKVKRFPFFFS

Show »
Length:416
Mass (Da):46,294
Checksum:iF44DFAFD659007B0
GO
Isoform 5 (identifier: Q96HH9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     105-105: Q → M

Show »
Length:328
Mass (Da):36,649
Checksum:i9B719A910D8AE809
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z4W8B7Z4W8_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
323Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PD09E9PD09_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
410Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6REP5D6REP5_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
288Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9P9D6R9P9_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFH3D6RFH3_HUMAN
GRAM domain-containing protein 2B
GRAMD2B
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti260Q → R in AAM77213 (Ref. 1) Curated1
Sequence conflicti260Q → R in BAB15045 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0442981 – 104Missing in isoform 5. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_0428831 – 68MTELQ…IISLW → MWKTQSLRKCSGRGRANLAQ PTQRLRMVWRRKRKPAGRQQ PNPLPHLWRRTPQTRRKSLA YAHIFSPNLCFIQDQE in isoform 2. 1 PublicationAdd BLAST68
Alternative sequenceiVSP_0428841 – 28MTELQ…LGSAH → MTRRQQVLQAKRSIQQTFQA QLMPWKSMFHGREVKPVGPD LEL in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0428851 – 28MTELQ…LGSAH → MSKVKRFPFFFS in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_044299105Q → M in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY116970 mRNA Translation: AAM77213.1
AK024966 mRNA Translation: BAB15045.1
AK293307 mRNA Translation: BAH11488.1
AK296267 mRNA Translation: BAH12297.1
AK300154 mRNA Translation: BAH13224.1
AK303857 mRNA Translation: BAH14068.1
AK316288 mRNA Translation: BAH14659.1
AC008546 Genomic DNA No translation available.
AC093535 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48852.1
CH471086 Genomic DNA Translation: EAW48854.1
CH471086 Genomic DNA Translation: EAW48855.1
BC008590 mRNA Translation: AAH08590.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4136.1 [Q96HH9-1]
CCDS54891.1 [Q96HH9-3]
CCDS54892.1 [Q96HH9-2]
CCDS54893.1 [Q96HH9-4]
CCDS54894.1 [Q96HH9-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001139791.1, NM_001146319.1 [Q96HH9-3]
NP_001139792.1, NM_001146320.1 [Q96HH9-5]
NP_001139793.1, NM_001146321.1 [Q96HH9-2]
NP_001139794.1, NM_001146322.1 [Q96HH9-4]
NP_076416.2, NM_023927.2 [Q96HH9-1]
XP_005272120.1, XM_005272063.3 [Q96HH9-4]
XP_016865274.1, XM_017009785.1 [Q96HH9-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000285689; ENSP00000285689; ENSG00000155324 [Q96HH9-1]
ENST00000511134; ENSP00000426088; ENSG00000155324 [Q96HH9-4]
ENST00000513040; ENSP00000426120; ENSG00000155324 [Q96HH9-3]
ENST00000542322; ENSP00000441876; ENSG00000155324 [Q96HH9-2]
ENST00000544396; ENSP00000444049; ENSG00000155324 [Q96HH9-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65983

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65983

UCSC genome browser

More...
UCSCi
uc003ktu.4, human [Q96HH9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY116970 mRNA Translation: AAM77213.1
AK024966 mRNA Translation: BAB15045.1
AK293307 mRNA Translation: BAH11488.1
AK296267 mRNA Translation: BAH12297.1
AK300154 mRNA Translation: BAH13224.1
AK303857 mRNA Translation: BAH14068.1
AK316288 mRNA Translation: BAH14659.1
AC008546 Genomic DNA No translation available.
AC093535 Genomic DNA No translation available.
CH471086 Genomic DNA Translation: EAW48852.1
CH471086 Genomic DNA Translation: EAW48854.1
CH471086 Genomic DNA Translation: EAW48855.1
BC008590 mRNA Translation: AAH08590.1
CCDSiCCDS4136.1 [Q96HH9-1]
CCDS54891.1 [Q96HH9-3]
CCDS54892.1 [Q96HH9-2]
CCDS54893.1 [Q96HH9-4]
CCDS54894.1 [Q96HH9-5]
RefSeqiNP_001139791.1, NM_001146319.1 [Q96HH9-3]
NP_001139792.1, NM_001146320.1 [Q96HH9-5]
NP_001139793.1, NM_001146321.1 [Q96HH9-2]
NP_001139794.1, NM_001146322.1 [Q96HH9-4]
NP_076416.2, NM_023927.2 [Q96HH9-1]
XP_005272120.1, XM_005272063.3 [Q96HH9-4]
XP_016865274.1, XM_017009785.1 [Q96HH9-5]

3D structure databases

SMRiQ96HH9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi122433, 35 interactors
IntActiQ96HH9, 29 interactors
MINTiQ96HH9
STRINGi9606.ENSP00000426120

PTM databases

iPTMnetiQ96HH9
PhosphoSitePlusiQ96HH9

Polymorphism and mutation databases

BioMutaiGRAMD2B
DMDMi74731934

Proteomic databases

EPDiQ96HH9
jPOSTiQ96HH9
MassIVEiQ96HH9
MaxQBiQ96HH9
PaxDbiQ96HH9
PeptideAtlasiQ96HH9
PRIDEiQ96HH9
ProteomicsDBi6327
76749 [Q96HH9-1]
76750 [Q96HH9-2]
76751 [Q96HH9-3]
76752 [Q96HH9-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2140, 212 antibodies

The DNASU plasmid repository

More...
DNASUi
65983

Genome annotation databases

EnsembliENST00000285689; ENSP00000285689; ENSG00000155324 [Q96HH9-1]
ENST00000511134; ENSP00000426088; ENSG00000155324 [Q96HH9-4]
ENST00000513040; ENSP00000426120; ENSG00000155324 [Q96HH9-3]
ENST00000542322; ENSP00000441876; ENSG00000155324 [Q96HH9-2]
ENST00000544396; ENSP00000444049; ENSG00000155324 [Q96HH9-5]
GeneIDi65983
KEGGihsa:65983
UCSCiuc003ktu.4, human [Q96HH9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65983
DisGeNETi65983
EuPathDBiHostDB:ENSG00000155324.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GRAMD2B
HGNCiHGNC:24911, GRAMD2B
HPAiENSG00000155324, Low tissue specificity
neXtProtiNX_Q96HH9
OpenTargetsiENSG00000155324
PharmGKBiPA142671711

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1032, Eukaryota
GeneTreeiENSGT00940000156980
InParanoidiQ96HH9
OMAiKCPTLHH
OrthoDBi944155at2759
PhylomeDBiQ96HH9
TreeFamiTF332065

Enzyme and pathway databases

PathwayCommonsiQ96HH9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
65983, 13 hits in 865 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
GRAMD2B, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65983
PharosiQ96HH9, Tdark

Protein Ontology

More...
PROi
PR:Q96HH9
RNActiQ96HH9, protein

Gene expression databases

BgeeiENSG00000155324, Expressed in calcaneal tendon and 228 other tissues
ExpressionAtlasiQ96HH9, baseline and differential
GenevisibleiQ96HH9, HS

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR004182, GRAM
IPR011993, PH-like_dom_sf
PfamiView protein in Pfam
PF02893, GRAM, 1 hit
SMARTiView protein in SMART
SM00568, GRAM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGRM2B_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96HH9
Secondary accession number(s): B7Z1F2
, B7Z3R1, B7Z6D8, B7Z8T2, D3DSZ3, Q9H753
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 1, 2001
Last modified: October 7, 2020
This is version 140 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again