Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q96HC4 (PDLI5_HUMAN)

Entry version 179 (11 Dec 2019)
Sequence version 5 (11 Jan 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

PDZ and LIM domain protein 5

Gene

PDLIM5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play an important role in the heart development by scaffolding PKC to the Z-disk region. May play a role in the regulation of cardiomyocyte expansion. Overexpression promotes the development of heart hypertrophy. Contributes to the regulation of dendritic spine morphogenesis in neurons. May restrain postsynaptic growth of excitatory synapses (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-6794361 Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PDZ and LIM domain protein 5
Alternative name(s):
Enigma homolog
Enigma-like PDZ and LIM domains protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PDLIM5
Synonyms:ENH
ORF Names:L9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000163110.14

Human Gene Nomenclature Database

More...HGNCi		HGNC:17468 PDLIM5

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		605904 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96HC4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Se��n O���Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		10611

Open Targets

More...OpenTargetsi		ENSG00000163110

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134917248

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96HC4 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PDLIM5

Domain mapping of disease mutations (DMDM)

More...DMDMi		317373590

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758772 – 596PDZ and LIM domain protein 5Add BLAST595

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylserineCombined sources1 Publication1
Modified residuei2PhosphoserineBy similarity1
Modified residuei89N6-acetyllysine; alternateBy similarity1
Modified residuei89N6-succinyllysine; alternateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki89Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei111PhosphoserineCombined sources1
Modified residuei134PhosphoserineCombined sources1
Modified residuei137PhosphoserineCombined sources1
Modified residuei228PhosphoserineBy similarity1
Modified residuei260PhosphoserineCombined sources1
Modified residuei309PhosphoserineCombined sources1
Modified residuei313PhosphoserineCombined sources1
Modified residuei322PhosphoserineBy similarity1
Modified residuei350N6-acetyllysineBy similarity1
Modified residuei360PhosphoserineCombined sources1
Modified residuei362PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96HC4

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96HC4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96HC4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96HC4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96HC4

PeptideAtlas

More...PeptideAtlasi		Q96HC4

PRoteomics IDEntifications database

More...PRIDEi		Q96HC4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		13553
19211
62593
76730 [Q96HC4-1]
76731 [Q96HC4-2]
76732 [Q96HC4-3]
76733 [Q96HC4-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96HC4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96HC4

SwissPalm database of S-palmitoylation events

More...SwissPalmi		Q96HC4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Heart and skeletal muscle specific. Expression is commonly increased in the brain of patients with bipolar disorder, schizophrenia, and major depression.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000163110 Expressed in 239 organ(s), highest expression level in biceps brachii

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96HC4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96HC4 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB013511
HPA016740
HPA020026

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with various PKC isoforms through the LIM domains.

Interacts (via LIM domains) with SIPA1L1.

Interacts (via PDZ domain) with actin and ACTN1 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		115857, 75 interactors

Database of interacting proteins

More...DIPi		DIP-34898N

Protein interaction database and analysis system

More...IntActi		Q96HC4, 38 interactors

Molecular INTeraction database

More...MINTi		Q96HC4

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000480359

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96HC4 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1596
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96HC4

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q96HC4

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2 – 85PDZPROSITE-ProRule annotationAdd BLAST84
Domaini418 – 477LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini477 – 536LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST60
Domaini536 – 596LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST61

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1703 Eukaryota
ENOG410XRD4 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155292

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000220936

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96HC4

KEGG Orthology (KO)

More...KOi		K19867

Identification of Orthologs from Complete Genome Data

More...OMAi		STNNMAY

Database of Orthologous Groups

More...OrthoDBi		1013114at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96HC4

TreeFam database of animal gene trees

More...TreeFami		TF106408

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR031847 DUF4749
IPR001478 PDZ
IPR036034 PDZ_sf
IPR001781 Znf_LIM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15936 DUF4749, 1 hit
PF00412 LIM, 3 hits
PF00595 PDZ, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00132 LIM, 3 hits
SM00228 PDZ, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50156 SSF50156, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 3 hits
PS50106 PDZ, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96HC4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSNYSVSLVG PAPWGFRLQG GKDFNMPLTI SSLKDGGKAA QANVRIGDVV 
        60         70         80         90        100
LSIDGINAQG MTHLEAQNKI KGCTGSLNMT LQRASAAPKP EPVPVQKGEP 
       110        120        130        140        150
KEVVKPVPIT SPAVSKVTST NNMAYNKAPR PFGSVSSPKV TSIPSPSSAF 
       160        170        180        190        200
TPAHATTSSH ASPSPVAAVT PPLFAASGLH ANANLSADQS PSALSAGKTA 
       210        220        230        240        250
VNVPRQPTVT SVCSETSQEL AEGQRRGSQG DSKQQNGPPR KHIVERYTEF 
       260        270        280        290        300
YHVPTHSDAS KKRLIEDTED WRPRTGTTQS RSFRILAQIT GTEHLKESEA 
       310        320        330        340        350
DNTKKANNSQ EPSPQLASSV ASTRSMPESL DSPTSGRPGV TSLTAAAAFK 
       360        370        380        390        400
PVGSTGVIKS PSWQRPNQGV PSTGRISNSA TYSGSVAPAN SALGQTQPSD 
       410        420        430        440        450
QDTLVQRAEH IPAGKRTPMC AHCNQVIRGP FLVALGKSWH PEEFNCAHCK 
       460        470        480        490        500
NTMAYIGFVE EKGALYCELC YEKFFAPECG RCQRKILGEV ISALKQTWHV 
       510        520        530        540        550
SCFVCVACGK PIRNNVFHLE DGEPYCETDY YALFGTICHG CEFPIEAGDM 
       560        570        580        590 
FLEALGYTWH DTCFVCSVCC ESLEGQTFFS KKDKPLCKKH AHSVNF
Length:596
Mass (Da):63,945
Last modified:January 11, 2011 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBBEAB9EDFA060736
GO
Isoform 2 (identifier: Q96HC4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GKIPPKR
     307-337: NNSQEPSPQLASSVASTRSMPESLDSPTSGR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-596: Missing.

Show »
Length:234
Mass (Da):25,930
Checksum:iAC29AA4B14829C09
GO
Isoform 3 (identifier: Q96HC4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-117: GEPKEVVKPVPITSPAVSKV → KTQVTNNPGTVKIPPKRPPR
     118-240: Missing.
     307-337: NNSQEPSPQLASSVASTRSMPESLDSPTSGR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-596: Missing.

Show »
Length:214
Mass (Da):23,823
Checksum:iFB118BF53EE7CDB4
GO
Isoform 4 (identifier: Q96HC4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.

Show »
Length:487
Mass (Da):53,078
Checksum:i2790407D3FF2DED5
GO
Isoform 5 (identifier: Q96HC4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-136: LKDGGKAAQA...KAPRPFGSVS → AGVQWRNLGS...ATIYPEIILY
     137-596: Missing.

Show »
Length:136
Mass (Da):15,116
Checksum:i33801E4A7B117739
GO
Isoform 6 (identifier: Q96HC4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GKIPPKR
     307-307: N → KFDSALEDLP...TGSIHVKKTS

Show »
Length:625
Mass (Da):67,729
Checksum:iFA6C01ACAE8B48B0
GO
Isoform 7 (identifier: Q96HC4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GKIPPKR
     587-596: Missing.

Show »
Length:483
Mass (Da):52,645
Checksum:iFE2F3A27E1EBFC11
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y8Y3H0Y8Y3_HUMAN
PDZ and LIM domain protein 5
PDLIM5
231Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSP3A0A0A0MSP3_HUMAN
PDZ and LIM domain protein 5
PDLIM5
271Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBI4H0YBI4_HUMAN
PDZ and LIM domain protein 5
PDLIM5
196Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SFR4A0A0D9SFR4_HUMAN
PDZ and LIM domain protein 5
PDLIM5
176Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y929H0Y929_HUMAN
PDZ and LIM domain protein 5
PDLIM5
85Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAA1D6RAA1_HUMAN
PDZ and LIM domain protein 5
PDLIM5
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RGG6D6RGG6_HUMAN
PDZ and LIM domain protein 5
PDLIM5
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0D9SFW3A0A0D9SFW3_HUMAN
PDZ and LIM domain protein 5
PDLIM5
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q96HC4-2)
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti221D → G in AL833438 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023779136S → F1 PublicationCorresponds to variant dbSNP:rs2452600Ensembl.1
Natural variantiVAR_046662319S → L2 PublicationsCorresponds to variant dbSNP:rs1064238Ensembl.1
Natural variantiVAR_046663345A → T6 PublicationsCorresponds to variant dbSNP:rs966845Ensembl.1
Natural variantiVAR_046664381T → A3 PublicationsCorresponds to variant dbSNP:rs7690296Ensembl.1
Natural variantiVAR_046665388P → S. Corresponds to variant dbSNP:rs7690464Ensembl.1
Natural variantiVAR_046666492S → NCombined sources6 PublicationsCorresponds to variant dbSNP:rs13107595Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04509833 – 136LKDGG…FGSVS → AGVQWRNLGSPQPPSPEFKR FSCLSLPSSWDYRHVPPRLA NFVFLVETKFPYVGQAGLEL PTSGDLPTSASQSAKITGVS HRAWPTLFYTLLFFATIYPE IILY in isoform 5. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_03907598 – 206Missing in isoform 2, isoform 4, isoform 6 and isoform 7. 2 PublicationsAdd BLAST109
Alternative sequenceiVSP_03920698 – 117GEPKE…AVSKV → KTQVTNNPGTVKIPPKRPPR in isoform 3. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_039207118 – 240Missing in isoform 3. 2 PublicationsAdd BLAST123
Alternative sequenceiVSP_045099137 – 596Missing in isoform 5. 1 PublicationAdd BLAST460
Alternative sequenceiVSP_039076237G → GKIPPKR in isoform 2, isoform 6 and isoform 7. 1 Publication1
Alternative sequenceiVSP_039077307 – 337NNSQE…PTSGR → KEKIPLHVFSPKYTKLRDWH HEVSARALNVQ in isoform 2 and isoform 3. 3 PublicationsAdd BLAST31
Alternative sequenceiVSP_053796307N → KFDSALEDLPKSGPHPPATP QVLTIGSQVATLSKVATTYS SLSSSTGNVEDSFEGFRNFS TFSSPARYSAAVLSSAAATV SAVIATKTRLYTPERYHSLL DALCISPVSKPLAFSYLQSS RKSTGSIHVKKTS in isoform 6. Curated1
Alternative sequenceiVSP_039078338 – 596Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST259
Alternative sequenceiVSP_053797587 – 596Missing in isoform 7. Curated10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF061258 mRNA Translation: AAC15767.1
AY345240 mRNA Translation: AAR09142.1
AY598328 mRNA Translation: AAT06739.1
BT007328 mRNA Translation: AAP35992.1
AK291624 mRNA Translation: BAF84313.1
AK291898 mRNA Translation: BAF84587.1
CR610626 mRNA No translation available.
AL833438 mRNA No translation available.
AC093778 Genomic DNA No translation available.
AC108067 Genomic DNA No translation available.
AC109925 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06054.1
BC017902 mRNA Translation: AAH17902.1
BC008741 mRNA Translation: AAH08741.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3641.1 [Q96HC4-1]
CCDS47102.1 [Q96HC4-4]
CCDS47103.1 [Q96HC4-2]
CCDS47104.1 [Q96HC4-3]
CCDS58915.1 [Q96HC4-5]
CCDS58916.1 [Q96HC4-6]
CCDS58917.1 [Q96HC4-7]

NCBI Reference Sequences

More...RefSeqi		NP_001011515.1, NM_001011515.2 [Q96HC4-2]
NP_001011516.1, NM_001011516.2 [Q96HC4-3]
NP_001243358.1, NM_001256429.1 [Q96HC4-5]
NP_006448.4, NM_006457.4 [Q96HC4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000317968; ENSP00000321746; ENSG00000163110 [Q96HC4-1]
ENST00000318007; ENSP00000322021; ENSG00000163110 [Q96HC4-3]
ENST00000359265; ENSP00000352210; ENSG00000163110 [Q96HC4-5]
ENST00000380180; ENSP00000369527; ENSG00000163110 [Q96HC4-2]
ENST00000503974; ENSP00000424297; ENSG00000163110 [Q96HC4-7]
ENST00000508216; ENSP00000426804; ENSG00000163110 [Q96HC4-2]
ENST00000514743; ENSP00000424360; ENSG00000163110 [Q96HC4-6]
ENST00000542407; ENSP00000442187; ENSG00000163110 [Q96HC4-4]
ENST00000615540; ENSP00000480359; ENSG00000163110 [Q96HC4-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10611

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10611

UCSC genome browser

More...UCSCi		uc003htf.5 human [Q96HC4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF061258 mRNA Translation: AAC15767.1
AY345240 mRNA Translation: AAR09142.1
AY598328 mRNA Translation: AAT06739.1
BT007328 mRNA Translation: AAP35992.1
AK291624 mRNA Translation: BAF84313.1
AK291898 mRNA Translation: BAF84587.1
CR610626 mRNA No translation available.
AL833438 mRNA No translation available.
AC093778 Genomic DNA No translation available.
AC108067 Genomic DNA No translation available.
AC109925 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06054.1
BC017902 mRNA Translation: AAH17902.1
BC008741 mRNA Translation: AAH08741.1
CCDSiCCDS3641.1 [Q96HC4-1]
CCDS47102.1 [Q96HC4-4]
CCDS47103.1 [Q96HC4-2]
CCDS47104.1 [Q96HC4-3]
CCDS58915.1 [Q96HC4-5]
CCDS58916.1 [Q96HC4-6]
CCDS58917.1 [Q96HC4-7]
RefSeqiNP_001011515.1, NM_001011515.2 [Q96HC4-2]
NP_001011516.1, NM_001011516.2 [Q96HC4-3]
NP_001243358.1, NM_001256429.1 [Q96HC4-5]
NP_006448.4, NM_006457.4 [Q96HC4-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DARNMR-A400-476[»]
2UZCX-ray1.50A/B/C/D/E1-83[»]
SMRiQ96HC4
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi115857, 75 interactors
DIPiDIP-34898N
IntActiQ96HC4, 38 interactors
MINTiQ96HC4
STRINGi9606.ENSP00000480359

PTM databases

iPTMnetiQ96HC4
PhosphoSitePlusiQ96HC4
SwissPalmiQ96HC4

Polymorphism and mutation databases

BioMutaiPDLIM5
DMDMi317373590

Proteomic databases

EPDiQ96HC4
jPOSTiQ96HC4
MassIVEiQ96HC4
MaxQBiQ96HC4
PaxDbiQ96HC4
PeptideAtlasiQ96HC4
PRIDEiQ96HC4
ProteomicsDBi13553
19211
62593
76730 [Q96HC4-1]
76731 [Q96HC4-2]
76732 [Q96HC4-3]
76733 [Q96HC4-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		10611

Genome annotation databases

EnsembliENST00000317968; ENSP00000321746; ENSG00000163110 [Q96HC4-1]
ENST00000318007; ENSP00000322021; ENSG00000163110 [Q96HC4-3]
ENST00000359265; ENSP00000352210; ENSG00000163110 [Q96HC4-5]
ENST00000380180; ENSP00000369527; ENSG00000163110 [Q96HC4-2]
ENST00000503974; ENSP00000424297; ENSG00000163110 [Q96HC4-7]
ENST00000508216; ENSP00000426804; ENSG00000163110 [Q96HC4-2]
ENST00000514743; ENSP00000424360; ENSG00000163110 [Q96HC4-6]
ENST00000542407; ENSP00000442187; ENSG00000163110 [Q96HC4-4]
ENST00000615540; ENSP00000480359; ENSG00000163110 [Q96HC4-6]
GeneIDi10611
KEGGihsa:10611
UCSCiuc003htf.5 human [Q96HC4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10611
DisGeNETi10611
EuPathDBiHostDB:ENSG00000163110.14

GeneCards: human genes, protein and diseases

More...GeneCardsi		PDLIM5
HGNCiHGNC:17468 PDLIM5
HPAiCAB013511
HPA016740
HPA020026
MIMi605904 gene
neXtProtiNX_Q96HC4
OpenTargetsiENSG00000163110
PharmGKBiPA134917248

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1703 Eukaryota
ENOG410XRD4 LUCA
GeneTreeiENSGT00940000155292
HOGENOMiHOG000220936
InParanoidiQ96HC4
KOiK19867
OMAiSTNNMAY
OrthoDBi1013114at2759
PhylomeDBiQ96HC4
TreeFamiTF106408

Enzyme and pathway databases

ReactomeiR-HSA-6794361 Neurexins and neuroligins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		PDLIM5 human
EvolutionaryTraceiQ96HC4

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		PDLIM5

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10611
PharosiQ96HC4 Tbio

Protein Ontology

More...PROi		PR:Q96HC4
RNActiQ96HC4 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000163110 Expressed in 239 organ(s), highest expression level in biceps brachii
ExpressionAtlasiQ96HC4 baseline and differential
GenevisibleiQ96HC4 HS

Family and domain databases

InterProiView protein in InterPro
IPR031847 DUF4749
IPR001478 PDZ
IPR036034 PDZ_sf
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF15936 DUF4749, 1 hit
PF00412 LIM, 3 hits
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 3 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 3 hits
PS50106 PDZ, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDLI5_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96HC4
Secondary accession number(s): A8K6F9
, D6RB78, E9PBF5, O60705, Q56VN4, Q5UW38, Q8WVK0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: January 11, 2011
Last modified: December 11, 2019
This is version 179 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again