Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q96HB5 (CC120_HUMAN)

Entry version 148 (23 Feb 2022)
Sequence version 1 (01 Dec 2001)
Previous versions | rss
Add a publicationFeedback
Protein

Coiled-coil domain-containing protein 120

Gene

CCDC120

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Centriolar protein required for centriole subdistal appendage assembly and microtubule anchoring in interphase cells (PubMed:28422092).

Together with CCDC68, cooperate with subdistal appendage components ODF2, NIN and CEP170 for hierarchical subdistal appendage assembly (PubMed:28422092).

Recruits NIN and CEP170 to centrosomes (PubMed:28422092).

Also required for neurite growth. Localizes CYTH2 to vesicles to allow its transport along neurites, and subsequent ARF6 activation and neurite growth.

1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q96HB5

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q96HB5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 120
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC120
ORF Names:JM11
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:28910, CCDC120

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300947, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q96HB5

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000147144

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Endosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000147144

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA145149329

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q96HB5, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CCDC120

Domain mapping of disease mutations (DMDM)

More...DMDMi		74731908

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002541411 – 630Coiled-coil domain-containing protein 120Add BLAST630

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei358PhosphoserineCombined sources1
Modified residuei360PhosphoserineCombined sources1
Modified residuei435Omega-N-methylarginineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Ubiquitinated; interaction with CYTH2 may prevent ubiquitination.1 Publication

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q96HB5

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q96HB5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q96HB5

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q96HB5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q96HB5

PeptideAtlas

More...PeptideAtlasi		Q96HB5

PRoteomics IDEntifications database

More...PRIDEi		Q96HB5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		25131
76728 [Q96HB5-1]
76729 [Q96HB5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q96HB5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q96HB5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000147144, Expressed in cerebellar vermis and 118 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q96HB5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q96HB5, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000147144, Tissue enhanced (esophagus, skin)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with NIN and CEP170; leading to recruit them to centrosomes (PubMed:28422092). Directly interacts with CYTH2; this interaction stabilizes CCDC120, possibly by preventing ubiquitination.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q96HB5
With#Exp.IntAct
AKAP8L [Q9ULX6]3EBI-744556,EBI-357530
ARID5A [Q03989]3EBI-744556,EBI-948603
ATP23 [Q9Y6H3]3EBI-744556,EBI-12811889
BCAS2 [O75934]3EBI-744556,EBI-1050106
BHLHB9 [Q6PI77]3EBI-744556,EBI-11519926
BLZF1 [Q9H2G9]5EBI-744556,EBI-2548012
C1orf109 [Q9NX04]3EBI-744556,EBI-8643161
CADPS [A2RRN7]3EBI-744556,EBI-10179719
CALCOCO2 [Q13137]3EBI-744556,EBI-739580
CARD9 - isoform 2 [Q9H257-2]3EBI-744556,EBI-11530605
CCDC102B [Q68D86]3EBI-744556,EBI-10171570
CCDC13 [Q8IYE1]3EBI-744556,EBI-10961312
CCDC57 - isoform 2 [Q2TAC2-2]3EBI-744556,EBI-10961624
CDR2 [Q01850]3EBI-744556,EBI-1181367
CEP170 [Q5SW79]12EBI-744556,EBI-1104799
CEP55 [Q53EZ4]3EBI-744556,EBI-747776
CKS1B [P61024]3EBI-744556,EBI-456371
CNFN [Q9BYD5]3EBI-744556,EBI-12819063
COG6 [Q9Y2V7]3EBI-744556,EBI-3866319
CTBP2 - isoform 3 [P56545-3]3EBI-744556,EBI-10171902
CYSRT1 [A8MQ03]3EBI-744556,EBI-3867333
CYTH1 [Q15438]9EBI-744556,EBI-997830
CYTH2 [Q99418]4EBI-744556,EBI-448974
CYTH3 - isoform 2 [O43739-2]4EBI-744556,EBI-11974015
CYTH4 [Q9UIA0]8EBI-744556,EBI-11521003
EFHC2 [Q5JST6]3EBI-744556,EBI-2349927
EIF3F [O00303]3EBI-744556,EBI-711990
FCHSD2 - isoform 3 [O94868-3]3EBI-744556,EBI-11958845
FGFR3 [P22607]3EBI-744556,EBI-348399
FOS [P01100]3EBI-744556,EBI-852851
FOSL1 [P15407]3EBI-744556,EBI-744510
FSD2 [A1L4K1]3EBI-744556,EBI-5661036
GAS2L2 [Q8NHY3]3EBI-744556,EBI-7960826
GFAP [P14136]3EBI-744556,EBI-744302
GOLGA2 [Q08379]3EBI-744556,EBI-618309
GOLGA6L9 [A6NEM1]3EBI-744556,EBI-5916454
HNRNPH1 [P31943]3EBI-744556,EBI-351590
HOMER3 [Q9NSC5]3EBI-744556,EBI-748420
HOXA1 [P49639]5EBI-744556,EBI-740785
HRAS [P01112]3EBI-744556,EBI-350145
HSF2BP [O75031]3EBI-744556,EBI-7116203
HTT [P42858]3EBI-744556,EBI-466029
IFT88 [Q13099]3EBI-744556,EBI-347427
IHO1 [Q8IYA8]3EBI-744556,EBI-8638439
INTS11 [Q5TA45]3EBI-744556,EBI-748258
KASH5 [Q8N6L0]3EBI-744556,EBI-749265
KRT31 [Q15323]3EBI-744556,EBI-948001
KRT34 [O76011]3EBI-744556,EBI-1047093
KRT35 [Q92764]3EBI-744556,EBI-1058674
KRT38 [O76015]3EBI-744556,EBI-1047263
KRTAP13-3 [Q3SY46]3EBI-744556,EBI-10241252
KRTAP19-1 [Q8IUB9]3EBI-744556,EBI-12811111
KRTAP6-1 [Q3LI64]3EBI-744556,EBI-12111050
KRTAP6-2 [Q3LI66]3EBI-744556,EBI-11962084
LMNB2 [Q03252]3EBI-744556,EBI-2830427
LMO4 [P61968]3EBI-744556,EBI-2798728
LZTS1 [Q9Y250]3EBI-744556,EBI-1216080
MAGED1 [Q9Y5V3]3EBI-744556,EBI-716006
MED11 [Q9P086]3EBI-744556,EBI-394704
METTL27 [Q8N6F8]3EBI-744556,EBI-8487781
MID2 - isoform 2 [Q9UJV3-2]3EBI-744556,EBI-10172526
MIIP [Q5JXC2]3EBI-744556,EBI-2801965
MIPOL1 [Q8TD10]6EBI-744556,EBI-2548751
MKRN3 [Q13064]3EBI-744556,EBI-2340269
MRPL38 [Q96DV4]3EBI-744556,EBI-720441
MTUS2 - isoform 2 [Q5JR59-3]3EBI-744556,EBI-11522433
MYOG [P15173]3EBI-744556,EBI-3906629
NCK2 [O43639]3EBI-744556,EBI-713635
NEK6 - isoform 4 [Q9HC98-4]3EBI-744556,EBI-11750983
NIN [Q8N4C6]11EBI-744556,EBI-1164022
NOTO [A8MTQ0]3EBI-744556,EBI-17490746
NXF1 [Q9UBU9]3EBI-744556,EBI-398874
ODF2 [Q5BJF6]5EBI-744556,EBI-8744243
PATZ1 - isoform 4 [Q9HBE1-4]3EBI-744556,EBI-11022007
PECAM1 [P16284]3EBI-744556,EBI-716404
PKP2 - isoform 1 [Q99959-2]3EBI-744556,EBI-10987518
PLA2G10 [O15496]3EBI-744556,EBI-726466
PLAGL2 [Q9UPG8]3EBI-744556,EBI-2876622
PLEKHG4 [Q58EX7]3EBI-744556,EBI-949255
POU2AF1 [Q16633]3EBI-744556,EBI-943588
PRDM6 [Q9NQX0]3EBI-744556,EBI-11320284
PRPH [P41219]3EBI-744556,EBI-752074
RAB5A [P20339]3EBI-744556,EBI-399437
RABEP1 [Q15276]3EBI-744556,EBI-447043
RBPMS - isoform C [Q93062-3]3EBI-744556,EBI-740343
RERE [Q9P2R6]3EBI-744556,EBI-948076
RINT1 [Q6NUQ1]3EBI-744556,EBI-726876
RUSC1 [Q9BVN2]3EBI-744556,EBI-6257312
SORBS3 [O60504]3EBI-744556,EBI-741237
SPAG8 - isoform 2 [Q99932-2]3EBI-744556,EBI-11959123
STX11 [O75558]3EBI-744556,EBI-714135
TFIP11 [Q9UBB9]3EBI-744556,EBI-1105213
TLE5 - isoform 2 [Q08117-2]6EBI-744556,EBI-11741437
TP53BP1 [Q12888]3EBI-744556,EBI-396540
TRAF1 [Q13077]3EBI-744556,EBI-359224
TRIM42 [Q8IWZ5]3EBI-744556,EBI-5235829
TRIP6 [Q15654]3EBI-744556,EBI-742327
TSC1 [Q86WV8]3EBI-744556,EBI-12806590
TSGA10IP [Q3SY00]3EBI-744556,EBI-10241197
VIM [P08670]3EBI-744556,EBI-353844
ZIM2 [Q9NZV7]3EBI-744556,EBI-11962760
ZMAT5 [Q9UDW3]3EBI-744556,EBI-7850213
ZNF417 [Q8TAU3]3EBI-744556,EBI-740727
ZNF648 [Q5T619]3EBI-744556,EBI-11985915
ZRANB1 [Q9UGI0]3EBI-744556,EBI-527853
Q9Y6493EBI-744556,EBI-25900580
Isoform 4 [Q96HB5-4]
With#Exp.IntAct
CCDC102B [Q68D86]4EBI-10185348,EBI-10171570
CCDC57 [Q2TAC2]3EBI-10185348,EBI-2808286
CEP170P1 [Q96L14]4EBI-10185348,EBI-743488
CYTH2 [Q99418]4EBI-10185348,EBI-448974
CYTH3 [O43739]3EBI-10185348,EBI-741648
EFHC2 [Q5JST6]4EBI-10185348,EBI-2349927
KRT31 [Q15323]4EBI-10185348,EBI-948001
KRT40 [Q6A162]4EBI-10185348,EBI-10171697
MID2 - isoform 2 [Q9UJV3-2]3EBI-10185348,EBI-10172526
TRAF1 [Q13077]4EBI-10185348,EBI-359224
USHBP1 [Q8N6Y0]3EBI-10185348,EBI-739895

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124658, 166 interactors

Protein interaction database and analysis system

More...IntActi		Q96HB5, 161 interactors

Molecular INTeraction database

More...MINTi		Q96HB5

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000474071

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q96HB5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q96HB5

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni31 – 70Involved in CYTH2-binding1 PublicationAdd BLAST40
Regioni212 – 435DisorderedSequence analysisAdd BLAST224
Regioni457 – 534DisorderedSequence analysisAdd BLAST78

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili109 – 173Sequence analysisAdd BLAST65

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi278 – 303Polar residuesSequence analysisAdd BLAST26
Compositional biasi408 – 422Pro residuesSequence analysisAdd BLAST15

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3529, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154102

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_029533_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q96HB5

Identification of Orthologs from Complete Genome Data

More...OMAi		AQRKQMK

Database of Orthologous Groups

More...OrthoDBi		595503at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q96HB5

TreeFam database of animal gene trees

More...TreeFami		TF328984

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039108, CCDC120
IPR043447, CCDC120/INAVA
IPR021774, DUF3338

The PANTHER Classification System

More...PANTHERi		PTHR16093, PTHR16093, 1 hit
PTHR16093:SF5, PTHR16093:SF5, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF11819, CUPID, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q96HB5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVKGQLISS PTFNAPAALF GEAAPQVKSE RLRGLLDRQR TLQEALSLKL 
        60         70         80         90        100
QELRKVCLQE AELTGQLPPE CPLEPGERPQ LVRRRPPTAR AYPPPHPNQA 
       110        120        130        140        150
HHSLCPAEEL ALEALEREVS VQQQIAAAAR RLALAPDLST EQRRRRRQVQ 
       160        170        180        190        200
ADALRRLHEL EEQLRDVRAR LGLPVLPLPQ PLPLSTGSVI TTQGVCLGMR 
       210        220        230        240        250
LAQLSQEDVV LHSESSSLSE SGASHDNEEP HGCFSLAERP SPPKAWDQLR 
       260        270        280        290        300
AVSGGSPERR TPWKPPPSDL YGDLKSRRNS VASPTSPTRS LPRSASSFEG 
       310        320        330        340        350
RSVPATPVLT RGAGPQLCKP EGLHSRQWSG SQDSQMGFPR ADPASDRASL 
       360        370        380        390        400
FVARTRRSNS SEALLVDRAA GGGAGSPPAP LAPSASGPPV CKSSEVLYER 
       410        420        430        440        450
PQPTPAFSSR TAGPPDPPRA ARPSSAAPAS RGAPRLPPVC GDFLLDYSLD 
       460        470        480        490        500
RGLPRSGGGT GWGELPPAAE VPGPLSRRDG LLTMLPGPPP VYAADSNSPL 
       510        520        530        540        550
LRTKDPHTRA TRTKPCGLPP EAAEGPEVHP NPLLWMPPPT RIPSAGERSG 
       560        570        580        590        600
HKNLALEGLR DWYIRNSGLA AGPQRRPVLP SVGPPHPPFL HARCYEVGQA 
       610        620        630
LYGAPSQAPL PHSRSFTAPP VSGRYGGCFY
Length:630
Mass (Da):67,567
Last modified:December 1, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE652C8AFD738BF6E
GO
Isoform 2 (identifier: Q96HB5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.

Show »
Length:618
Mass (Da):66,354
Checksum:i3BB9CCCF52CB53F0
GO
Isoform 3 (identifier: Q96HB5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Show »
Length:661
Mass (Da):70,911
Checksum:i45084D2BED260DC9
GO
Isoform 4 (identifier: Q96HB5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRREPRYQGQVGPDIHTDSERTLSSHQPRPLDSTKM
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Show »
Length:696
Mass (Da):74,970
Checksum:iB9722ECBDF715B75
GO
Isoform 5 (identifier: Q96HB5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Show »
Length:649
Mass (Da):69,698
Checksum:i149F30E4292E9782
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3T7S4R3T7_HUMAN
Coiled-coil domain-containing prote...
CCDC120
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0545271M → MRREPRYQGQVGPDIHTDSE RTLSSHQPRPLDSTKM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0428595 – 16Missing in isoform 2 and isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_047104626 – 630GGCFY → YADFLYPPELSARLSDLTLE GEQSSSSDTQTPGTLV in isoform 3, isoform 4 and isoform 5. 1 Publication5

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
DQ896186 mRNA No translation available.
AK293898 mRNA Translation: BAG57285.1
AK294024 mRNA Translation: BAG57382.1
AK291370 mRNA Translation: BAF84059.1
AK300366 mRNA Translation: BAG62104.1
AK315837 mRNA Translation: BAF98728.1
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50708.1
BC008769 mRNA Translation: AAH08769.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14316.1 [Q96HB5-1]
CCDS55413.1 [Q96HB5-2]
CCDS55414.2 [Q96HB5-4]

NCBI Reference Sequences

More...RefSeqi		NP_001156793.2, NM_001163321.2 [Q96HB5-4]
NP_001156794.1, NM_001163322.2 [Q96HB5-5]
NP_001156795.1, NM_001163323.2 [Q96HB5-2]
NP_001258764.1, NM_001271835.1 [Q96HB5-1]
NP_001258765.1, NM_001271836.1 [Q96HB5-1]
NP_296375.1, NM_033626.3 [Q96HB5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000496529; ENSP00000474761; ENSG00000147144
ENST00000536628; ENSP00000443351; ENSG00000147144 [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144
ENST00000603986; ENSP00000474071; ENSG00000147144 [Q96HB5-4]
ENST00000606812; ENSP00000475676; ENSG00000147144

Database of genes from NCBI RefSeq genomes

More...GeneIDi		90060

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:90060

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000603986.6; ENSP00000474071.1; NM_001163321.4; NP_001156793.2 [Q96HB5-4]

UCSC genome browser

More...UCSCi		uc064zdh.1, human [Q96HB5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ896186 mRNA No translation available.
AK293898 mRNA Translation: BAG57285.1
AK294024 mRNA Translation: BAG57382.1
AK291370 mRNA Translation: BAF84059.1
AK300366 mRNA Translation: BAG62104.1
AK315837 mRNA Translation: BAF98728.1
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50708.1
BC008769 mRNA Translation: AAH08769.1
CCDSiCCDS14316.1 [Q96HB5-1]
CCDS55413.1 [Q96HB5-2]
CCDS55414.2 [Q96HB5-4]
RefSeqiNP_001156793.2, NM_001163321.2 [Q96HB5-4]
NP_001156794.1, NM_001163322.2 [Q96HB5-5]
NP_001156795.1, NM_001163323.2 [Q96HB5-2]
NP_001258764.1, NM_001271835.1 [Q96HB5-1]
NP_001258765.1, NM_001271836.1 [Q96HB5-1]
NP_296375.1, NM_033626.3 [Q96HB5-1]

3D structure databases

SMRiQ96HB5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124658, 166 interactors
IntActiQ96HB5, 161 interactors
MINTiQ96HB5
STRINGi9606.ENSP00000474071

PTM databases

iPTMnetiQ96HB5
PhosphoSitePlusiQ96HB5

Genetic variation databases

BioMutaiCCDC120
DMDMi74731908

Proteomic databases

EPDiQ96HB5
jPOSTiQ96HB5
MassIVEiQ96HB5
MaxQBiQ96HB5
PaxDbiQ96HB5
PeptideAtlasiQ96HB5
PRIDEiQ96HB5
ProteomicsDBi25131
76728 [Q96HB5-1]
76729 [Q96HB5-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		347, 116 antibodies from 21 providers

The DNASU plasmid repository

More...DNASUi		90060

Genome annotation databases

EnsembliENST00000496529; ENSP00000474761; ENSG00000147144
ENST00000536628; ENSP00000443351; ENSG00000147144 [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144
ENST00000603986; ENSP00000474071; ENSG00000147144 [Q96HB5-4]
ENST00000606812; ENSP00000475676; ENSG00000147144
GeneIDi90060
KEGGihsa:90060
MANE-SelectiENST00000603986.6; ENSP00000474071.1; NM_001163321.4; NP_001156793.2 [Q96HB5-4]
UCSCiuc064zdh.1, human [Q96HB5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		90060

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCDC120
HGNCiHGNC:28910, CCDC120
HPAiENSG00000147144, Tissue enhanced (esophagus, skin)
MIMi300947, gene
neXtProtiNX_Q96HB5
OpenTargetsiENSG00000147144
PharmGKBiPA145149329
VEuPathDBiHostDB:ENSG00000147144

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3529, Eukaryota
GeneTreeiENSGT00940000154102
HOGENOMiCLU_029533_0_0_1
InParanoidiQ96HB5
OMAiAQRKQMK
OrthoDBi595503at2759
PhylomeDBiQ96HB5
TreeFamiTF328984

Enzyme and pathway databases

PathwayCommonsiQ96HB5
SignaLinkiQ96HB5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		90060, 1 hit in 679 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CCDC120, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		90060
PharosiQ96HB5, Tbio

Protein Ontology

More...PROi		PR:Q96HB5
RNActiQ96HB5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000147144, Expressed in cerebellar vermis and 118 other tissues
ExpressionAtlasiQ96HB5, baseline and differential
GenevisibleiQ96HB5, HS

Family and domain databases

InterProiView protein in InterPro
IPR039108, CCDC120
IPR043447, CCDC120/INAVA
IPR021774, DUF3338
PANTHERiPTHR16093, PTHR16093, 1 hit
PTHR16093:SF5, PTHR16093:SF5, 1 hit
PfamiView protein in Pfam
PF11819, CUPID, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC120_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q96HB5
Secondary accession number(s): A8K5Q5
, B4DF24, B4DFC1, B4DTU2, F5GZU4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: February 23, 2022
This is version 148 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again